BLASTX nr result
ID: Akebia25_contig00040398
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00040398 (202 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007051399.1| Homeodomain-like superfamily protein isoform... 73 4e-11 ref|XP_007051397.1| Homeodomain-like superfamily protein isoform... 73 4e-11 ref|XP_007051396.1| Homeodomain-like superfamily protein isoform... 73 4e-11 ref|XP_007051395.1| Homeodomain-like superfamily protein isoform... 73 4e-11 dbj|BAK19069.1| late elongated hypocotyl homolog [Ipomoea nil] 73 4e-11 gb|AAQ73524.1| circadian clock associated1 [Mesembryanthemum cry... 72 6e-11 ref|XP_006491393.1| PREDICTED: protein LHY-like isoform X5 [Citr... 71 1e-10 ref|XP_006491389.1| PREDICTED: protein LHY-like isoform X1 [Citr... 71 1e-10 ref|XP_006444706.1| hypothetical protein CICLE_v10018964mg [Citr... 71 1e-10 ref|XP_006386665.1| hypothetical protein POPTR_0002s18190g [Popu... 71 2e-10 ref|XP_002301448.2| hypothetical protein POPTR_0002s18190g [Popu... 71 2e-10 ref|XP_006386663.1| hypothetical protein POPTR_0002s18190g [Popu... 71 2e-10 gb|AEA50874.1| lhy1 [Populus tremula] 71 2e-10 dbj|BAH09382.1| transcription factor LHY [Populus nigra] gi|2196... 71 2e-10 ref|XP_006352623.1| PREDICTED: protein LHY-like [Solanum tuberosum] 70 2e-10 ref|XP_004248416.1| PREDICTED: protein LHY-like [Solanum lycoper... 70 2e-10 gb|AFA35964.1| late elongated hypocotyl [Nicotiana attenuata] 70 2e-10 ref|XP_007139035.1| hypothetical protein PHAVU_009G259600g [Phas... 70 3e-10 gb|AAU20773.1| late elongated hypocotyl [Castanea sativa] 70 3e-10 emb|CBI38726.3| unnamed protein product [Vitis vinifera] 70 3e-10 >ref|XP_007051399.1| Homeodomain-like superfamily protein isoform 5 [Theobroma cacao] gi|590720702|ref|XP_007051403.1| Homeodomain-like superfamily protein isoform 5 [Theobroma cacao] gi|590720706|ref|XP_007051404.1| Homeodomain-like superfamily protein isoform 5 [Theobroma cacao] gi|508703660|gb|EOX95556.1| Homeodomain-like superfamily protein isoform 5 [Theobroma cacao] gi|508703664|gb|EOX95560.1| Homeodomain-like superfamily protein isoform 5 [Theobroma cacao] gi|508703665|gb|EOX95561.1| Homeodomain-like superfamily protein isoform 5 [Theobroma cacao] Length = 707 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+TYSS EEL+IKTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDTYSSGEELVIKTRKPYTITKQRERWTEEEHNRFL 36 >ref|XP_007051397.1| Homeodomain-like superfamily protein isoform 3 [Theobroma cacao] gi|590720695|ref|XP_007051401.1| Homeodomain-like superfamily protein isoform 3 [Theobroma cacao] gi|590720699|ref|XP_007051402.1| Homeodomain-like superfamily protein isoform 3 [Theobroma cacao] gi|508703658|gb|EOX95554.1| Homeodomain-like superfamily protein isoform 3 [Theobroma cacao] gi|508703662|gb|EOX95558.1| Homeodomain-like superfamily protein isoform 3 [Theobroma cacao] gi|508703663|gb|EOX95559.1| Homeodomain-like superfamily protein isoform 3 [Theobroma cacao] Length = 700 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+TYSS EEL+IKTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDTYSSGEELVIKTRKPYTITKQRERWTEEEHNRFL 36 >ref|XP_007051396.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao] gi|590720685|ref|XP_007051398.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao] gi|590720692|ref|XP_007051400.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao] gi|508703657|gb|EOX95553.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao] gi|508703659|gb|EOX95555.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao] gi|508703661|gb|EOX95557.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao] Length = 668 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+TYSS EEL+IKTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDTYSSGEELVIKTRKPYTITKQRERWTEEEHNRFL 36 >ref|XP_007051395.1| Homeodomain-like superfamily protein isoform 1 [Theobroma cacao] gi|590720710|ref|XP_007051405.1| Homeodomain-like superfamily protein isoform 1 [Theobroma cacao] gi|590720714|ref|XP_007051406.1| Homeodomain-like superfamily protein isoform 1 [Theobroma cacao] gi|508703656|gb|EOX95552.1| Homeodomain-like superfamily protein isoform 1 [Theobroma cacao] gi|508703666|gb|EOX95562.1| Homeodomain-like superfamily protein isoform 1 [Theobroma cacao] gi|508703667|gb|EOX95563.1| Homeodomain-like superfamily protein isoform 1 [Theobroma cacao] Length = 739 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+TYSS EEL+IKTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDTYSSGEELVIKTRKPYTITKQRERWTEEEHNRFL 36 >dbj|BAK19069.1| late elongated hypocotyl homolog [Ipomoea nil] Length = 776 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+TYSS EEL+IKTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDTYSSGEELVIKTRKPYTITKQRERWTEEEHNRFL 36 >gb|AAQ73524.1| circadian clock associated1 [Mesembryanthemum crystallinum] Length = 739 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 ME YSS EEL+IKTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MEAYSSGEELVIKTRKPYTITKQRERWTEEEHNRFL 36 >ref|XP_006491393.1| PREDICTED: protein LHY-like isoform X5 [Citrus sinensis] Length = 659 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+TYSS E+L++KTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDTYSSGEDLVLKTRKPYTITKQRERWTEEEHNRFL 36 >ref|XP_006491389.1| PREDICTED: protein LHY-like isoform X1 [Citrus sinensis] gi|568876654|ref|XP_006491390.1| PREDICTED: protein LHY-like isoform X2 [Citrus sinensis] gi|568876656|ref|XP_006491391.1| PREDICTED: protein LHY-like isoform X3 [Citrus sinensis] gi|568876658|ref|XP_006491392.1| PREDICTED: protein LHY-like isoform X4 [Citrus sinensis] Length = 765 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+TYSS E+L++KTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDTYSSGEDLVLKTRKPYTITKQRERWTEEEHNRFL 36 >ref|XP_006444706.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|567904438|ref|XP_006444707.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|567904440|ref|XP_006444708.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|567904442|ref|XP_006444709.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|567904444|ref|XP_006444710.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|557546968|gb|ESR57946.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|557546969|gb|ESR57947.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|557546970|gb|ESR57948.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|557546971|gb|ESR57949.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|557546972|gb|ESR57950.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] Length = 765 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+TYSS E+L++KTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDTYSSGEDLVLKTRKPYTITKQRERWTEEEHNRFL 36 >ref|XP_006386665.1| hypothetical protein POPTR_0002s18190g [Populus trichocarpa] gi|550345285|gb|ERP64462.1| hypothetical protein POPTR_0002s18190g [Populus trichocarpa] Length = 687 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+TYS+ E+L+IKTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDTYSAGEDLVIKTRKPYTITKQRERWTEEEHNRFL 36 >ref|XP_002301448.2| hypothetical protein POPTR_0002s18190g [Populus trichocarpa] gi|550345284|gb|EEE80721.2| hypothetical protein POPTR_0002s18190g [Populus trichocarpa] Length = 630 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+TYS+ E+L+IKTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDTYSAGEDLVIKTRKPYTITKQRERWTEEEHNRFL 36 >ref|XP_006386663.1| hypothetical protein POPTR_0002s18190g [Populus trichocarpa] gi|566158675|ref|XP_006386664.1| hypothetical protein POPTR_0002s18190g [Populus trichocarpa] gi|566158677|ref|XP_002301449.2| hypothetical protein POPTR_0002s18190g [Populus trichocarpa] gi|550345281|gb|ERP64460.1| hypothetical protein POPTR_0002s18190g [Populus trichocarpa] gi|550345282|gb|ERP64461.1| hypothetical protein POPTR_0002s18190g [Populus trichocarpa] gi|550345283|gb|EEE80722.2| hypothetical protein POPTR_0002s18190g [Populus trichocarpa] Length = 768 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+TYS+ E+L+IKTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDTYSAGEDLVIKTRKPYTITKQRERWTEEEHNRFL 36 >gb|AEA50874.1| lhy1 [Populus tremula] Length = 146 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+TYS+ E+L+IKTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDTYSAGEDLVIKTRKPYTITKQRERWTEEEHNRFL 36 >dbj|BAH09382.1| transcription factor LHY [Populus nigra] gi|219687747|dbj|BAH09384.1| PnLHY1 [Populus nigra] Length = 768 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+TYS+ E+L+IKTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDTYSAGEDLVIKTRKPYTITKQRERWTEEEHNRFL 36 >ref|XP_006352623.1| PREDICTED: protein LHY-like [Solanum tuberosum] Length = 763 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+ YSS EEL++KTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDPYSSGEELVVKTRKPYTITKQRERWTEEEHNRFL 36 >ref|XP_004248416.1| PREDICTED: protein LHY-like [Solanum lycopersicum] Length = 762 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+ YSS EEL++KTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDPYSSGEELVVKTRKPYTITKQRERWTEEEHNRFL 36 >gb|AFA35964.1| late elongated hypocotyl [Nicotiana attenuata] Length = 767 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+ YSS EEL++KTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDPYSSGEELVVKTRKPYTITKQRERWTEEEHNRFL 36 >ref|XP_007139035.1| hypothetical protein PHAVU_009G259600g [Phaseolus vulgaris] gi|593331219|ref|XP_007139036.1| hypothetical protein PHAVU_009G259600g [Phaseolus vulgaris] gi|561012122|gb|ESW11029.1| hypothetical protein PHAVU_009G259600g [Phaseolus vulgaris] gi|561012123|gb|ESW11030.1| hypothetical protein PHAVU_009G259600g [Phaseolus vulgaris] Length = 88 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+ YSS EE++IKTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDAYSSGEEVVIKTRKPYTITKQRERWTEEEHNRFL 36 >gb|AAU20773.1| late elongated hypocotyl [Castanea sativa] Length = 768 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+TYSS EEL+IK RKPYTITKQRERWTE+EHNRFL Sbjct: 1 MDTYSSGEELVIKARKPYTITKQRERWTEDEHNRFL 36 >emb|CBI38726.3| unnamed protein product [Vitis vinifera] Length = 218 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 109 METYSSVEELIIKTRKPYTITKQRERWTEEEHNRFL 2 M+ YSS E+LIIKTRKPYTITKQRERWTEEEHNRFL Sbjct: 1 MDIYSSGEDLIIKTRKPYTITKQRERWTEEEHNRFL 36