BLASTX nr result
ID: Akebia25_contig00039996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00039996 (265 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOO01583.1| hypothetical protein UCRPA7_2912 [Togninia minima... 58 2e-06 ref|XP_001225124.1| hypothetical protein CHGG_07468 [Chaetomium ... 56 5e-06 >gb|EOO01583.1| hypothetical protein UCRPA7_2912 [Togninia minima UCRPA7] Length = 192 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/64 (45%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +2 Query: 2 LQINSTWSCG------PLRSGTATGPALNLDCKKDVYQNSNWTIGQIYSSTNVNCAPAQF 163 L IN TW+C P+ A L L+C +QN NWTIGQIYS V CAP Sbjct: 122 LDINQTWTCDDPDPQYPITFHAAGTVNLTLECTDTTWQNPNWTIGQIYSDREVKCAPVTV 181 Query: 164 DVKP 175 VKP Sbjct: 182 PVKP 185 >ref|XP_001225124.1| hypothetical protein CHGG_07468 [Chaetomium globosum CBS 148.51] gi|88178747|gb|EAQ86215.1| hypothetical protein CHGG_07468 [Chaetomium globosum CBS 148.51] Length = 195 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/64 (42%), Positives = 37/64 (57%), Gaps = 6/64 (9%) Frame = +2 Query: 2 LQINSTWSCG---PLRSGTATGPA---LNLDCKKDVYQNSNWTIGQIYSSTNVNCAPAQF 163 L++N TW+C P T TG L LDCK ++N +W +GQIYSS + CAP + Sbjct: 125 LRVNQTWTCDDNDPQYPTTFTGRGSIDLPLDCKDQTWKNPDWEMGQIYSSRTITCAPVES 184 Query: 164 DVKP 175 +KP Sbjct: 185 TIKP 188