BLASTX nr result
ID: Akebia25_contig00039871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00039871 (386 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB37439.1| Ras-related protein [Morus notabilis] 57 3e-06 ref|XP_007031654.1| GTP-binding 2 [Theobroma cacao] gi|508710683... 55 8e-06 >gb|EXB37439.1| Ras-related protein [Morus notabilis] Length = 226 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 3 SSGIKVGHGRAIGPPGARDGAITQRGGCCS 92 SSGIKVG+GR GPPGARDG + QRGGCCS Sbjct: 197 SSGIKVGYGRPQGPPGARDGTVAQRGGCCS 226 >ref|XP_007031654.1| GTP-binding 2 [Theobroma cacao] gi|508710683|gb|EOY02580.1| GTP-binding 2 [Theobroma cacao] Length = 211 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +3 Query: 3 SSGIKVGHGRAIGPPGARDGAITQRGGCC 89 SSGIK+G+GRA GP GARDGA+ QRGGCC Sbjct: 182 SSGIKIGYGRAQGPSGARDGAVAQRGGCC 210