BLASTX nr result
ID: Akebia25_contig00039613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00039613 (201 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006468083.1| PREDICTED: uncharacterized protein LOC102630... 111 1e-22 ref|XP_006436375.1| hypothetical protein CICLE_v10032622mg [Citr... 111 1e-22 ref|XP_002513316.1| hypothetical protein RCOM_1573710 [Ricinus c... 110 2e-22 ref|XP_002311898.2| hypothetical protein POPTR_0008s00510g [Popu... 109 5e-22 ref|XP_007215929.1| hypothetical protein PRUPE_ppa011045mg [Prun... 108 8e-22 ref|XP_007023675.1| Lipid-binding serum glycoprotein family prot... 106 3e-21 ref|XP_004303807.1| PREDICTED: uncharacterized protein LOC101311... 106 4e-21 gb|EXB53785.1| hypothetical protein L484_002017 [Morus notabilis] 104 1e-20 ref|XP_003632921.1| PREDICTED: uncharacterized protein LOC100244... 101 9e-20 ref|XP_002266798.1| PREDICTED: uncharacterized protein LOC100244... 101 9e-20 emb|CAN79114.1| hypothetical protein VITISV_007010 [Vitis vinifera] 101 9e-20 ref|XP_006342854.1| PREDICTED: uncharacterized protein LOC102602... 101 1e-19 gb|EEC84817.1| hypothetical protein OsI_31899 [Oryza sativa Indi... 96 4e-18 ref|XP_006660792.1| PREDICTED: uncharacterized protein LOC102716... 94 2e-17 ref|XP_006660791.1| PREDICTED: uncharacterized protein LOC102716... 94 2e-17 gb|EEE69982.1| hypothetical protein OsJ_29884 [Oryza sativa Japo... 94 3e-17 ref|XP_004957247.1| PREDICTED: uncharacterized protein LOC101752... 92 7e-17 tpg|DAA40430.1| TPA: putative cyclin-like F-box domain family pr... 92 7e-17 ref|NP_001152702.1| lipid binding protein [Zea mays] gi|19565917... 92 7e-17 ref|XP_002462603.1| hypothetical protein SORBIDRAFT_02g028850 [S... 92 1e-16 >ref|XP_006468083.1| PREDICTED: uncharacterized protein LOC102630194 [Citrus sinensis] Length = 236 Score = 111 bits (277), Expect = 1e-22 Identities = 49/55 (89%), Positives = 51/55 (92%) Frame = -1 Query: 201 VFLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 VFLPYPYSRS +VQWRVFEKLFTDFRDCFN+VDYYDVL CAKNKFQ IPS WLGY Sbjct: 182 VFLPYPYSRSIQVQWRVFEKLFTDFRDCFNQVDYYDVLACAKNKFQPIPSLWLGY 236 >ref|XP_006436375.1| hypothetical protein CICLE_v10032622mg [Citrus clementina] gi|567887708|ref|XP_006436376.1| hypothetical protein CICLE_v10032622mg [Citrus clementina] gi|557538571|gb|ESR49615.1| hypothetical protein CICLE_v10032622mg [Citrus clementina] gi|557538572|gb|ESR49616.1| hypothetical protein CICLE_v10032622mg [Citrus clementina] Length = 236 Score = 111 bits (277), Expect = 1e-22 Identities = 49/55 (89%), Positives = 51/55 (92%) Frame = -1 Query: 201 VFLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 VFLPYPYSRS +VQWRVFEKLFTDFRDCFN+VDYYDVL CAKNKFQ IPS WLGY Sbjct: 182 VFLPYPYSRSIQVQWRVFEKLFTDFRDCFNQVDYYDVLACAKNKFQPIPSLWLGY 236 >ref|XP_002513316.1| hypothetical protein RCOM_1573710 [Ricinus communis] gi|223547224|gb|EEF48719.1| hypothetical protein RCOM_1573710 [Ricinus communis] Length = 236 Score = 110 bits (275), Expect = 2e-22 Identities = 47/55 (85%), Positives = 52/55 (94%) Frame = -1 Query: 201 VFLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 VFLPYPY++S KVQWRV+EKLFTDFRDCFN VDYYDVL+CAKNKFQ IPS+WLGY Sbjct: 182 VFLPYPYTKSIKVQWRVYEKLFTDFRDCFNHVDYYDVLSCAKNKFQPIPSAWLGY 236 >ref|XP_002311898.2| hypothetical protein POPTR_0008s00510g [Populus trichocarpa] gi|550332074|gb|EEE89265.2| hypothetical protein POPTR_0008s00510g [Populus trichocarpa] Length = 235 Score = 109 bits (272), Expect = 5e-22 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = -1 Query: 201 VFLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 VFLPYPY++S KVQW+VFEKLFTDFRDCFN VDYYDVL CAKNKFQ IPS+WLGY Sbjct: 181 VFLPYPYTKSIKVQWKVFEKLFTDFRDCFNHVDYYDVLGCAKNKFQPIPSAWLGY 235 >ref|XP_007215929.1| hypothetical protein PRUPE_ppa011045mg [Prunus persica] gi|462412079|gb|EMJ17128.1| hypothetical protein PRUPE_ppa011045mg [Prunus persica] Length = 226 Score = 108 bits (270), Expect = 8e-22 Identities = 48/55 (87%), Positives = 50/55 (90%) Frame = -1 Query: 201 VFLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 VFLPYPYSRS KVQWRVFEKLFTDFRDCF+ VDYYDVL+CAK KFQ IPS WLGY Sbjct: 172 VFLPYPYSRSIKVQWRVFEKLFTDFRDCFDNVDYYDVLSCAKTKFQPIPSIWLGY 226 >ref|XP_007023675.1| Lipid-binding serum glycoprotein family protein isoform 1 [Theobroma cacao] gi|508779041|gb|EOY26297.1| Lipid-binding serum glycoprotein family protein isoform 1 [Theobroma cacao] Length = 236 Score = 106 bits (265), Expect = 3e-21 Identities = 47/55 (85%), Positives = 49/55 (89%) Frame = -1 Query: 201 VFLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 VFLPYPYSRS KVQW+VFEKLFTDFRDC NR DYYDVL AKNKFQ IPS+WLGY Sbjct: 182 VFLPYPYSRSIKVQWKVFEKLFTDFRDCLNRADYYDVLAMAKNKFQPIPSAWLGY 236 >ref|XP_004303807.1| PREDICTED: uncharacterized protein LOC101311014 [Fragaria vesca subsp. vesca] Length = 236 Score = 106 bits (264), Expect = 4e-21 Identities = 47/55 (85%), Positives = 49/55 (89%) Frame = -1 Query: 201 VFLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 VFLPYPYSRS KVQW+VFEKLFTDFRDC N VDYYDVL CAKNKFQ IPS WLG+ Sbjct: 182 VFLPYPYSRSIKVQWKVFEKLFTDFRDCLNYVDYYDVLACAKNKFQPIPSIWLGH 236 >gb|EXB53785.1| hypothetical protein L484_002017 [Morus notabilis] Length = 233 Score = 104 bits (260), Expect = 1e-20 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = -1 Query: 201 VFLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 VFLPYPY+RS KVQWRVFEKL TDFRDCF+ VDYYDVL CAK+KFQ IPS+WLG+ Sbjct: 179 VFLPYPYTRSIKVQWRVFEKLLTDFRDCFSHVDYYDVLACAKSKFQPIPSAWLGF 233 >ref|XP_003632921.1| PREDICTED: uncharacterized protein LOC100244390 isoform 2 [Vitis vinifera] Length = 228 Score = 101 bits (252), Expect = 9e-20 Identities = 45/55 (81%), Positives = 47/55 (85%) Frame = -1 Query: 201 VFLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 VFLPYPYSRS KVQWRVFEKLFTDFRDC + DYYDVL AK KFQ IPS+WLGY Sbjct: 174 VFLPYPYSRSIKVQWRVFEKLFTDFRDCLSHADYYDVLAIAKTKFQPIPSAWLGY 228 >ref|XP_002266798.1| PREDICTED: uncharacterized protein LOC100244390 isoform 1 [Vitis vinifera] gi|297735756|emb|CBI18443.3| unnamed protein product [Vitis vinifera] Length = 236 Score = 101 bits (252), Expect = 9e-20 Identities = 45/55 (81%), Positives = 47/55 (85%) Frame = -1 Query: 201 VFLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 VFLPYPYSRS KVQWRVFEKLFTDFRDC + DYYDVL AK KFQ IPS+WLGY Sbjct: 182 VFLPYPYSRSIKVQWRVFEKLFTDFRDCLSHADYYDVLAIAKTKFQPIPSAWLGY 236 >emb|CAN79114.1| hypothetical protein VITISV_007010 [Vitis vinifera] Length = 432 Score = 101 bits (252), Expect = 9e-20 Identities = 45/55 (81%), Positives = 47/55 (85%) Frame = -1 Query: 201 VFLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 VFLPYPYSRS KVQWRVFEKLFTDFRDC + DYYDVL AK KFQ IPS+WLGY Sbjct: 378 VFLPYPYSRSIKVQWRVFEKLFTDFRDCLSHADYYDVLAIAKTKFQPIPSAWLGY 432 >ref|XP_006342854.1| PREDICTED: uncharacterized protein LOC102602568 [Solanum tuberosum] Length = 236 Score = 101 bits (251), Expect = 1e-19 Identities = 42/55 (76%), Positives = 48/55 (87%) Frame = -1 Query: 201 VFLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 V LP+PYSRSYKVQWRVFE+LFTDFRDC N V+Y D+L CAK KFQ +PS+WLGY Sbjct: 182 VILPFPYSRSYKVQWRVFERLFTDFRDCLNHVEYCDLLACAKQKFQQVPSAWLGY 236 >gb|EEC84817.1| hypothetical protein OsI_31899 [Oryza sativa Indica Group] Length = 243 Score = 96.3 bits (238), Expect = 4e-18 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = -1 Query: 198 FLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 FLP+PYSRSYKV WRVF+KLFTDFRDCF+RVDY+D L AK++FQ +PS+WLG+ Sbjct: 190 FLPFPYSRSYKVLWRVFDKLFTDFRDCFSRVDYHDALAGAKSRFQPVPSAWLGH 243 >ref|XP_006660792.1| PREDICTED: uncharacterized protein LOC102716806 isoform X2 [Oryza brachyantha] Length = 226 Score = 94.0 bits (232), Expect = 2e-17 Identities = 39/54 (72%), Positives = 48/54 (88%) Frame = -1 Query: 198 FLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 FLP+PYSRSYKV WRVF+KLFTD RDCF+RVDY+D L AK++FQ +PS+WLG+ Sbjct: 173 FLPFPYSRSYKVLWRVFDKLFTDLRDCFSRVDYHDALAGAKSRFQPVPSTWLGH 226 >ref|XP_006660791.1| PREDICTED: uncharacterized protein LOC102716806 isoform X1 [Oryza brachyantha] Length = 263 Score = 94.0 bits (232), Expect = 2e-17 Identities = 39/54 (72%), Positives = 48/54 (88%) Frame = -1 Query: 198 FLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 FLP+PYSRSYKV WRVF+KLFTD RDCF+RVDY+D L AK++FQ +PS+WLG+ Sbjct: 210 FLPFPYSRSYKVLWRVFDKLFTDLRDCFSRVDYHDALAGAKSRFQPVPSTWLGH 263 >gb|EEE69982.1| hypothetical protein OsJ_29884 [Oryza sativa Japonica Group] Length = 301 Score = 93.6 bits (231), Expect = 3e-17 Identities = 39/54 (72%), Positives = 48/54 (88%) Frame = -1 Query: 198 FLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 FLP+PYSRSYKV WRVF+KLFTDFRDCF+R DY+D L AK++FQ +PS+WLG+ Sbjct: 248 FLPFPYSRSYKVLWRVFDKLFTDFRDCFSRGDYHDALAGAKSRFQPVPSAWLGH 301 >ref|XP_004957247.1| PREDICTED: uncharacterized protein LOC101752510 [Setaria italica] Length = 227 Score = 92.0 bits (227), Expect = 7e-17 Identities = 37/54 (68%), Positives = 48/54 (88%) Frame = -1 Query: 198 FLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 FLP+PYSRSYKV WRV++KLFTDFRDCF+ DY+D L+ AK++FQ +PS+WLG+ Sbjct: 174 FLPFPYSRSYKVLWRVYDKLFTDFRDCFSGADYHDALSTAKSRFQPVPSTWLGH 227 >tpg|DAA40430.1| TPA: putative cyclin-like F-box domain family protein [Zea mays] Length = 227 Score = 92.0 bits (227), Expect = 7e-17 Identities = 37/54 (68%), Positives = 49/54 (90%) Frame = -1 Query: 198 FLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 FLP+PYSRSY+V WRVF+KLFTDFRDCF+ +Y+DVL+ AK++FQ +PS+WLG+ Sbjct: 174 FLPFPYSRSYRVLWRVFDKLFTDFRDCFSGAEYHDVLSTAKSRFQPVPSTWLGH 227 >ref|NP_001152702.1| lipid binding protein [Zea mays] gi|195659173|gb|ACG49054.1| lipid binding protein [Zea mays] Length = 227 Score = 92.0 bits (227), Expect = 7e-17 Identities = 37/54 (68%), Positives = 49/54 (90%) Frame = -1 Query: 198 FLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 FLP+PYSRSY+V WRVF+KLFTDFRDCF+ +Y+DVL+ AK++FQ +PS+WLG+ Sbjct: 174 FLPFPYSRSYRVLWRVFDKLFTDFRDCFSGAEYHDVLSTAKSRFQPVPSTWLGH 227 >ref|XP_002462603.1| hypothetical protein SORBIDRAFT_02g028850 [Sorghum bicolor] gi|241925980|gb|EER99124.1| hypothetical protein SORBIDRAFT_02g028850 [Sorghum bicolor] Length = 289 Score = 91.7 bits (226), Expect = 1e-16 Identities = 37/54 (68%), Positives = 48/54 (88%) Frame = -1 Query: 198 FLPYPYSRSYKVQWRVFEKLFTDFRDCFNRVDYYDVLTCAKNKFQHIPSSWLGY 37 FLP+PYSRSYKV WRVF+KLFTDFRDCF+ +Y+D L+ AK++FQ +PS+WLG+ Sbjct: 236 FLPFPYSRSYKVLWRVFDKLFTDFRDCFSGAEYHDALSTAKSRFQPVPSTWLGH 289