BLASTX nr result
ID: Akebia25_contig00039485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00039485 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS88189.1| hypothetical protein PFICI_02017 [Pestalotiopsis ... 70 3e-10 gb|ELR03163.1| hypothetical protein GMDG_05989 [Pseudogymnoascus... 64 3e-08 ref|XP_001907229.1| hypothetical protein [Podospora anserina S m... 57 3e-06 >gb|ETS88189.1| hypothetical protein PFICI_02017 [Pestalotiopsis fici W106-1] Length = 401 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -2 Query: 108 MTMTLDHQQQRYGAINFDHMSSYHAPHFTNPWAAAS 1 MTMTLDHQ QRYGA++FDHMSSYH P F+NPWA+AS Sbjct: 1 MTMTLDHQPQRYGALHFDHMSSYHTPSFSNPWASAS 36 >gb|ELR03163.1| hypothetical protein GMDG_05989 [Pseudogymnoascus destructans 20631-21] Length = 398 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = -2 Query: 108 MTMTLDHQQQRYGAINFDHMSSYHAPHFTNPWAAAS 1 MTM +DHQQ+++GA+NFDHM H+PHFTNPW+A+S Sbjct: 1 MTMAIDHQQRQFGALNFDHMPYNHSPHFTNPWSASS 36 >ref|XP_001907229.1| hypothetical protein [Podospora anserina S mat+] gi|18077657|emb|CAD12881.1| putative C2H2 zinc finger protein [Podospora anserina] gi|170942248|emb|CAP67900.1| unnamed protein product [Podospora anserina S mat+] Length = 381 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/38 (65%), Positives = 31/38 (81%), Gaps = 2/38 (5%) Frame = -2 Query: 108 MTMTLD-HQQQRYGAINFDHMSSYHA-PHFTNPWAAAS 1 MTMT+D H Q R+G++NFDHMSSY + PHFTNPW + S Sbjct: 1 MTMTIDTHNQHRFGSLNFDHMSSYSSHPHFTNPWVSTS 38