BLASTX nr result
ID: Akebia25_contig00039484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00039484 (209 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006372189.1| cytochrome P450 71B10 family protein [Populu... 67 2e-09 ref|XP_003634559.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 emb|CBI18522.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002518234.1| pentatricopeptide repeat-containing protein,... 67 2e-09 emb|CAN75781.1| hypothetical protein VITISV_012425 [Vitis vinifera] 67 2e-09 ref|XP_007014387.1| Pentatricopeptide repeat superfamily protein... 67 3e-09 ref|XP_007212775.1| hypothetical protein PRUPE_ppa019758mg [Prun... 65 1e-08 ref|XP_004296481.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 ref|XP_006474246.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_006453278.1| hypothetical protein CICLE_v10010743mg, part... 62 6e-08 ref|XP_006357612.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_004487970.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 gb|EXB30979.1| hypothetical protein L484_016839 [Morus notabilis] 60 4e-07 dbj|BAA96948.1| salt-inducible protein-like [Arabidopsis thaliana] 57 3e-06 ref|XP_003547448.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|NP_001078759.1| pentatricopeptide repeat-containing protein ... 57 3e-06 ref|XP_004239478.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >ref|XP_006372189.1| cytochrome P450 71B10 family protein [Populus trichocarpa] gi|550318714|gb|ERP49986.1| cytochrome P450 71B10 family protein [Populus trichocarpa] Length = 1075 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/53 (60%), Positives = 42/53 (79%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKIETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFP 51 EMLQ +S+ ELINR ++ETES+ LVFLC+QGSI+EA +VL+EV S+ FP Sbjct: 923 EMLQSQSVKELINRVNTEVETESIESILVFLCEQGSIKEAVTVLNEVSSVFFP 975 >ref|XP_003634559.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like [Vitis vinifera] Length = 993 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/53 (60%), Positives = 42/53 (79%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKIETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFP 51 EMLQ S+ ELINR +IETES+ F++ LC+QGSI+EA +VL+EVGS+ FP Sbjct: 839 EMLQTRSVLELINRVDTEIETESVESFIISLCEQGSIQEAVTVLNEVGSIFFP 891 >emb|CBI18522.3| unnamed protein product [Vitis vinifera] Length = 808 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/53 (60%), Positives = 42/53 (79%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKIETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFP 51 EMLQ S+ ELINR +IETES+ F++ LC+QGSI+EA +VL+EVGS+ FP Sbjct: 694 EMLQTRSVLELINRVDTEIETESVESFIISLCEQGSIQEAVTVLNEVGSIFFP 746 >ref|XP_002518234.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542581|gb|EEF44120.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 932 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/53 (54%), Positives = 44/53 (83%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKIETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFP 51 EMLQ +S+ EL+N+ ++ETES+ FL+FLC++GSI+EA +VL+E+GS+ FP Sbjct: 800 EMLQSQSVMELLNKVNTEVETESIESFLLFLCEKGSIKEAVAVLNEIGSLFFP 852 >emb|CAN75781.1| hypothetical protein VITISV_012425 [Vitis vinifera] Length = 993 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/53 (60%), Positives = 42/53 (79%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKIETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFP 51 EMLQ S+ ELINR +IETES+ F++ LC+QGSI+EA +VL+EVGS+ FP Sbjct: 839 EMLQTRSVLELINRVDTEIETESVESFIISLCEQGSIQEAVTVLNEVGSIFFP 891 >ref|XP_007014387.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508784750|gb|EOY32006.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 1087 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/53 (60%), Positives = 42/53 (79%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKIETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFP 51 EMLQ +S+ +LINR +IE+ES+ FLV+LC+QGSI+EA VLSE+GS FP Sbjct: 933 EMLQTKSVMQLINRIDTEIESESIESFLVYLCEQGSIQEALVVLSEIGSRLFP 985 >ref|XP_007212775.1| hypothetical protein PRUPE_ppa019758mg [Prunus persica] gi|462408640|gb|EMJ13974.1| hypothetical protein PRUPE_ppa019758mg [Prunus persica] Length = 1104 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/53 (54%), Positives = 43/53 (81%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKIETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFP 51 EMLQ +S+ ELINR ++ET+SL G LV LC+QGS++E+ ++L+E+GS+ FP Sbjct: 951 EMLQSQSVVELINRVDVEVETDSLEGLLVSLCEQGSVQESLTLLNEIGSIFFP 1003 >ref|XP_004296481.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 1013 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/58 (51%), Positives = 44/58 (75%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKIETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFPSKGRS 36 +MLQ +S+ ELIN+ +++T+SL FLV LC+QGSI+EA +VL+E+ SM FP + S Sbjct: 867 KMLQSQSVVELINKVDVELKTDSLESFLVSLCEQGSIQEAVTVLNEIASMFFPIRDSS 924 >ref|XP_006474246.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X1 [Citrus sinensis] gi|568840585|ref|XP_006474247.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X2 [Citrus sinensis] Length = 1074 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/55 (52%), Positives = 42/55 (76%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKIETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFPSK 45 EMLQ +S+ ELINR ++E+ES+ FL+ LC+QGSI EA ++L E+G M FP++ Sbjct: 930 EMLQSKSVLELINRVDIEVESESVLNFLISLCEQGSILEAIAILDEIGYMLFPTQ 984 >ref|XP_006453278.1| hypothetical protein CICLE_v10010743mg, partial [Citrus clementina] gi|557556504|gb|ESR66518.1| hypothetical protein CICLE_v10010743mg, partial [Citrus clementina] Length = 1036 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/55 (52%), Positives = 42/55 (76%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKIETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFPSK 45 EMLQ +S+ ELINR ++E+ES+ FL+ LC+QGSI EA ++L E+G M FP++ Sbjct: 892 EMLQSKSVLELINRVDIEVESESVLNFLISLCEQGSILEAIAILDEIGYMLFPTQ 946 >ref|XP_006357612.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like [Solanum tuberosum] Length = 1057 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/61 (47%), Positives = 44/61 (72%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKIETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFPSKGRSIG 30 EM Q +S+ +L++R +IETES+ FL LC+QGSI+EA ++L+EV SM FP + + + Sbjct: 926 EMFQSKSVIDLLDRVESEIETESIRSFLSLLCEQGSIQEAVNILNEVVSMFFPVRKKRVD 985 Query: 29 S 27 S Sbjct: 986 S 986 >ref|XP_004487970.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X1 [Cicer arietinum] gi|502085668|ref|XP_004487971.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X2 [Cicer arietinum] gi|502085671|ref|XP_004487972.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X3 [Cicer arietinum] gi|502085674|ref|XP_004487973.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X4 [Cicer arietinum] gi|502085678|ref|XP_004487974.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X5 [Cicer arietinum] gi|502085682|ref|XP_004487975.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X6 [Cicer arietinum] Length = 1070 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/70 (45%), Positives = 47/70 (67%), Gaps = 3/70 (4%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKIETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFPSKGRSI- 33 EMLQ E++T+ IN +++TES+ FL LC+QGSI+EA +VL+E+ M FP + S Sbjct: 915 EMLQSENVTDTINIVNSEVDTESIYDFLATLCEQGSIQEAVTVLNEIACMFFPVQRLSTY 974 Query: 32 --GSTKLKKL 9 GS K +K+ Sbjct: 975 NQGSDKSQKI 984 >gb|EXB30979.1| hypothetical protein L484_016839 [Morus notabilis] Length = 1240 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/55 (54%), Positives = 39/55 (70%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKIETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFPSK 45 EMLQ ES ELIN+ + E ESL L+ LC+QGSI+EA +VL+EV S+ FP + Sbjct: 917 EMLQSESAMELINKVDTEEEAESLESLLICLCEQGSIKEAVTVLNEVASIYFPPR 971 >dbj|BAA96948.1| salt-inducible protein-like [Arabidopsis thaliana] Length = 1012 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/70 (45%), Positives = 49/70 (70%), Gaps = 2/70 (2%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKI-ETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFPSKGRSI 33 EML ES+ +LINR ++ E+ES+ GFLV LC+QG + +A +L E+ S +PS G+++ Sbjct: 896 EMLVSESVVKLINRVDAELAESESIRGFLVELCEQGRVPQAIKILDEISSTIYPS-GKNL 954 Query: 32 GS-TKLKKLN 6 GS +L+ LN Sbjct: 955 GSYQRLQFLN 964 >ref|XP_003547448.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X1 [Glycine max] gi|571519120|ref|XP_006597790.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X2 [Glycine max] gi|571519126|ref|XP_006597791.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X3 [Glycine max] gi|571519129|ref|XP_006597792.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X4 [Glycine max] gi|571519133|ref|XP_006597793.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X5 [Glycine max] Length = 1064 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/70 (41%), Positives = 48/70 (68%), Gaps = 3/70 (4%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKIETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFPSKGRSI- 33 EMLQ +++ ELIN ++++TES++ FL LC+QG ++EA +VL+E+ + FP + S Sbjct: 910 EMLQSKNVVELINIVNKEVDTESISDFLGTLCEQGRVQEAVTVLNEIVCILFPVQRLSTY 969 Query: 32 --GSTKLKKL 9 GS K +K+ Sbjct: 970 NQGSLKQQKI 979 >ref|NP_001078759.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635742|sp|Q9LVD3.2|PP434_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g57250, mitochondrial; Flags: Precursor gi|332009488|gb|AED96871.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 971 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/70 (45%), Positives = 49/70 (70%), Gaps = 2/70 (2%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKI-ETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFPSKGRSI 33 EML ES+ +LINR ++ E+ES+ GFLV LC+QG + +A +L E+ S +PS G+++ Sbjct: 855 EMLVSESVVKLINRVDAELAESESIRGFLVELCEQGRVPQAIKILDEISSTIYPS-GKNL 913 Query: 32 GS-TKLKKLN 6 GS +L+ LN Sbjct: 914 GSYQRLQFLN 923 >ref|XP_004239478.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like [Solanum lycopersicum] Length = 1047 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/61 (42%), Positives = 42/61 (68%) Frame = -1 Query: 209 EMLQIESMTELINRAGRKIETESLAGFLVFLCDQGSIEEATSVLSEVGSMAFPSKGRSIG 30 EM Q +S+ +L++R +I TES+ FL LC+QGS++EA ++L+EV +M FP + + Sbjct: 916 EMFQSKSVIDLLDRVESEIGTESIRSFLSLLCEQGSVQEAVNILNEVVTMFFPVREKRAD 975 Query: 29 S 27 S Sbjct: 976 S 976