BLASTX nr result
ID: Akebia25_contig00039299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00039299 (712 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME88295.1| hypothetical protein MYCFIDRAFT_86068 [Pseudocerc... 57 8e-06 >gb|EME88295.1| hypothetical protein MYCFIDRAFT_86068 [Pseudocercospora fijiensis CIRAD86] Length = 360 Score = 56.6 bits (135), Expect = 8e-06 Identities = 33/93 (35%), Positives = 43/93 (46%) Frame = +1 Query: 247 DAAGVVRSTTSPIQSTAVAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDANGHVEVVT 426 D+ G V +T SP+ AVA D G V +VT Sbjct: 216 DSEGSVVTTASPLSIVAVAPGGSVVASSADMVGHTVVLSRPTPGGVYTTTDNTGEVAIVT 275 Query: 427 VFPGGGQASEIILQTTTDPDGQRRTITSYKQIG 525 PGGG SE+ ++TTT PDGQR TITS+ ++G Sbjct: 276 YTPGGGTVSELQVRTTTLPDGQRSTITSFAEVG 308