BLASTX nr result
ID: Akebia25_contig00039134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00039134 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008081401.1| ribosomal protein S8 (chloroplast) [Tetracen... 165 5e-39 gb|ADD29870.1| ribosomal protein S8 [Meliosma aff. cuneifolia Mo... 164 2e-38 ref|YP_001294220.1| ribosomal protein S8 [Buxus microphylla] gi|... 163 2e-38 ref|YP_008993298.1| ribosomal protein S8 (chloroplast) [Magnolia... 160 1e-37 ref|YP_002836126.1| ribosomal protein S8 [Megaleranthis saniculi... 160 2e-37 ref|YP_740686.1| ribosomal protein S8 [Nandina domestica] gi|122... 160 2e-37 ref|YP_008577528.1| ribosomal protein S8 (chloroplast) [Eucalypt... 160 2e-37 ref|YP_008575658.1| ribosomal protein S8 (chloroplast) [Eucalypt... 160 2e-37 ref|YP_636334.1| ribosomal protein S8 [Eucalyptus globulus subsp... 160 2e-37 ref|YP_004021351.1| ribosomal protein S8 [Theobroma cacao] gi|30... 160 2e-37 ref|YP_008993470.1| ribosomal protein S8 (chloroplast) [Magnolia... 159 3e-37 ref|YP_740601.1| ribosomal protein S8 [Platanus occidentalis] gi... 159 3e-37 ref|YP_001294134.1| ribosomal protein S8 [Chloranthus spicatus] ... 159 4e-37 ref|YP_008993814.1| ribosomal protein S8 (chloroplast) [Magnolia... 159 5e-37 ref|YP_008993384.1| ribosomal protein S8 (chloroplast) [Magnolia... 159 5e-37 ref|YP_004769750.1| ribosomal protein S8 [Magnolia kwangsiensis]... 159 5e-37 ref|YP_740238.1| ribosomal protein S8 [Liriodendron tulipifera] ... 159 5e-37 ref|YP_004842273.1| ribosomal protein S8 [Pyrus pyrifolia] gi|56... 158 6e-37 gb|ADZ54489.1| ribosomal protein S8 [Portulaca cryptopetala] 158 6e-37 gb|ADD29882.1| ribosomal protein S8 [Heuchera sanguinea] 158 6e-37 >ref|YP_008081401.1| ribosomal protein S8 (chloroplast) [Tetracentron sinense] gi|511348507|ref|YP_008081435.1| ribosomal protein S8 (chloroplast) [Tetracentron sinense] gi|511348567|ref|YP_008081493.1| ribosomal protein S8 (chloroplast) [Trochodendron aralioides] gi|511348600|ref|YP_008081526.1| ribosomal protein S8 (chloroplast) [Trochodendron aralioides] gi|290487008|gb|ADD29888.1| ribosomal protein S8 [Trochodendron aralioides] gi|479279239|gb|AGJ72093.1| ribosomal protein S8 (chloroplast) [Tetracentron sinense] gi|479279272|gb|AGJ72126.1| ribosomal protein S8 (chloroplast) [Tetracentron sinense] gi|479279332|gb|AGJ72185.1| ribosomal protein S8 (chloroplast) [Trochodendron aralioides] gi|479279365|gb|AGJ72218.1| ribosomal protein S8 (chloroplast) [Trochodendron aralioides] Length = 132 Score = 165 bits (418), Expect = 5e-39 Identities = 81/83 (97%), Positives = 81/83 (97%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 128 KHRESNK FLV TLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS Sbjct: 50 KHRESNKYFLVSTLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 109 Query: 127 RGIMTDREARLEGIGGEILCYIW 59 RGIMTDREARLEGIGGEILCYIW Sbjct: 110 RGIMTDREARLEGIGGEILCYIW 132 >gb|ADD29870.1| ribosomal protein S8 [Meliosma aff. cuneifolia Moore 333] Length = 132 Score = 164 bits (414), Expect = 2e-38 Identities = 80/83 (96%), Positives = 81/83 (97%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 128 KHRESNK FLV TLRHRRNRKGPYRTILKRISRPGLRI+SNYQRIPRILGGMGIVILSTS Sbjct: 50 KHRESNKYFLVSTLRHRRNRKGPYRTILKRISRPGLRIFSNYQRIPRILGGMGIVILSTS 109 Query: 127 RGIMTDREARLEGIGGEILCYIW 59 RGIMTDREARLEGIGGEILCYIW Sbjct: 110 RGIMTDREARLEGIGGEILCYIW 132 >ref|YP_001294220.1| ribosomal protein S8 [Buxus microphylla] gi|158706198|sp|A6MM72.1|RR8_BUXMI RecName: Full=30S ribosomal protein S8, chloroplastic gi|146762320|gb|ABQ45284.1| ribosomal protein S8 [Buxus microphylla] Length = 132 Score = 163 bits (413), Expect = 2e-38 Identities = 80/83 (96%), Positives = 81/83 (97%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 128 KHRESNK FLV TLRHRR+RKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS Sbjct: 50 KHRESNKYFLVSTLRHRRSRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 109 Query: 127 RGIMTDREARLEGIGGEILCYIW 59 RGIMTDREARLEGIGGEILCYIW Sbjct: 110 RGIMTDREARLEGIGGEILCYIW 132 >ref|YP_008993298.1| ribosomal protein S8 (chloroplast) [Magnolia dealbata] Length = 132 Score = 160 bits (406), Expect = 1e-37 Identities = 78/83 (93%), Positives = 80/83 (96%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 128 KHRE+NK FLV TLRHRRNRKG YRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS Sbjct: 50 KHRENNKYFLVSTLRHRRNRKGTYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 109 Query: 127 RGIMTDREARLEGIGGEILCYIW 59 RGIMTDREARLEGIGGE+LCYIW Sbjct: 110 RGIMTDREARLEGIGGEVLCYIW 132 >ref|YP_002836126.1| ribosomal protein S8 [Megaleranthis saniculifolia] gi|226933918|gb|ACO92051.1| ribosomal protein S8 [Megaleranthis saniculifolia] Length = 132 Score = 160 bits (405), Expect = 2e-37 Identities = 78/83 (93%), Positives = 80/83 (96%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 128 KHR S K FLVLTLRHRRNRKGPYRT+LKRISRPGLRIYSN+QRIPRILGGMGIVILSTS Sbjct: 50 KHRASKKCFLVLTLRHRRNRKGPYRTVLKRISRPGLRIYSNHQRIPRILGGMGIVILSTS 109 Query: 127 RGIMTDREARLEGIGGEILCYIW 59 RGIMTDREARLEGIGGEILCYIW Sbjct: 110 RGIMTDREARLEGIGGEILCYIW 132 >ref|YP_740686.1| ribosomal protein S8 [Nandina domestica] gi|122165926|sp|Q09FS5.1|RR8_NANDO RecName: Full=30S ribosomal protein S8, chloroplastic gi|114054507|gb|ABI49900.1| ribosomal protein S8 [Nandina domestica] Length = 132 Score = 160 bits (405), Expect = 2e-37 Identities = 78/83 (93%), Positives = 81/83 (97%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 128 KHRE+++ FLV TLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS Sbjct: 50 KHRENDQFFLVSTLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 109 Query: 127 RGIMTDREARLEGIGGEILCYIW 59 RGIMTDREARLEGIGGEILCYIW Sbjct: 110 RGIMTDREARLEGIGGEILCYIW 132 >ref|YP_008577528.1| ribosomal protein S8 (chloroplast) [Eucalyptus erythrocorys] gi|442568768|gb|AGC58937.1| ribosomal protein S8 (chloroplast) [Eucalyptus erythrocorys] Length = 134 Score = 160 bits (404), Expect = 2e-37 Identities = 80/85 (94%), Positives = 82/85 (96%), Gaps = 2/85 (2%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTIL--KRISRPGLRIYSNYQRIPRILGGMGIVILS 134 KH+E+NK FLVLTLRHRRNRKGPYRTIL KRISRPGLRIYSNYQRIPRILGGMGIVILS Sbjct: 50 KHQENNKYFLVLTLRHRRNRKGPYRTILNLKRISRPGLRIYSNYQRIPRILGGMGIVILS 109 Query: 133 TSRGIMTDREARLEGIGGEILCYIW 59 TSRGIMTDREARLEGIGGEILCYIW Sbjct: 110 TSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_008575658.1| ribosomal protein S8 (chloroplast) [Eucalyptus sieberi] gi|545716882|ref|YP_008575743.1| ribosomal protein S8 (chloroplast) [Eucalyptus elata] gi|545716968|ref|YP_008575828.1| ribosomal protein S8 (chloroplast) [Eucalyptus regnans] gi|442566704|gb|AGC56897.1| ribosomal protein S8 (chloroplast) [Eucalyptus sieberi] gi|442566790|gb|AGC56982.1| ribosomal protein S8 (chloroplast) [Eucalyptus elata] gi|442566876|gb|AGC57067.1| ribosomal protein S8 (chloroplast) [Eucalyptus regnans] Length = 134 Score = 160 bits (404), Expect = 2e-37 Identities = 80/85 (94%), Positives = 82/85 (96%), Gaps = 2/85 (2%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTIL--KRISRPGLRIYSNYQRIPRILGGMGIVILS 134 KH+E+NK FLVLTLRHRRNRKGPYRTIL KRISRPGLRIYSNYQRIPRILGGMGIVILS Sbjct: 50 KHQENNKYFLVLTLRHRRNRKGPYRTILNLKRISRPGLRIYSNYQRIPRILGGMGIVILS 109 Query: 133 TSRGIMTDREARLEGIGGEILCYIW 59 TSRGIMTDREARLEGIGGEILCYIW Sbjct: 110 TSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_636334.1| ribosomal protein S8 [Eucalyptus globulus subsp. globulus] gi|309322481|ref|YP_003933995.1| ribosomal protein S8 [Eucalyptus grandis] gi|545716280|ref|YP_008575148.1| ribosomal protein S8 (chloroplast) [Eucalyptus obliqua] gi|545716366|ref|YP_008575233.1| ribosomal protein S8 (chloroplast) [Eucalyptus radiata] gi|545716452|ref|YP_008575318.1| ribosomal protein S8 (chloroplast) [Eucalyptus delegatensis] gi|545716538|ref|YP_008575403.1| ribosomal protein S8 (chloroplast) [Eucalyptus verrucata] gi|545716624|ref|YP_008575488.1| ribosomal protein S8 (chloroplast) [Eucalyptus baxteri] gi|545716710|ref|YP_008575573.1| ribosomal protein S8 (chloroplast) [Eucalyptus diversifolia] gi|545717054|ref|YP_008575913.1| ribosomal protein S8 (chloroplast) [Eucalyptus umbra] gi|545717140|ref|YP_008575998.1| ribosomal protein S8 (chloroplast) [Eucalyptus cloeziana] gi|545717226|ref|YP_008576083.1| ribosomal protein S8 (chloroplast) [Eucalyptus patens] gi|545717312|ref|YP_008576168.1| ribosomal protein S8 (chloroplast) [Eucalyptus marginata] gi|545717398|ref|YP_008576253.1| ribosomal protein S8 (chloroplast) [Eucalyptus curtisii] gi|545717484|ref|YP_008576338.1| ribosomal protein S8 (chloroplast) [Eucalyptus melliodora] gi|545717570|ref|YP_008576423.1| ribosomal protein S8 (chloroplast) [Eucalyptus polybractea] gi|545717656|ref|YP_008576508.1| ribosomal protein S8 (chloroplast) [Eucalyptus cladocalyx] gi|545717742|ref|YP_008576593.1| ribosomal protein S8 (chloroplast) [Eucalyptus nitens] gi|545717828|ref|YP_008576678.1| ribosomal protein S8 (chloroplast) [Eucalyptus aromaphloia] gi|545717914|ref|YP_008576763.1| ribosomal protein S8 (chloroplast) [Eucalyptus saligna] gi|545718000|ref|YP_008576848.1| ribosomal protein S8 (chloroplast) [Eucalyptus camaldulensis] gi|545718086|ref|YP_008576933.1| ribosomal protein S8 (chloroplast) [Eucalyptus deglupta] gi|545718172|ref|YP_008577018.1| ribosomal protein S8 (chloroplast) [Eucalyptus spathulata] gi|545718258|ref|YP_008577103.1| ribosomal protein S8 (chloroplast) [Eucalyptus torquata] gi|545718344|ref|YP_008577188.1| ribosomal protein S8 (chloroplast) [Eucalyptus diversicolor] gi|545718430|ref|YP_008577273.1| ribosomal protein S8 (chloroplast) [Eucalyptus salmonophloia] gi|545718602|ref|YP_008577443.1| ribosomal protein S8 (chloroplast) [Eucalyptus guilfoylei] gi|545718774|ref|YP_008577613.1| ribosomal protein S8 (chloroplast) [Corymbia gummifera] gi|545718860|ref|YP_008577698.1| ribosomal protein S8 (chloroplast) [Corymbia maculata] gi|545718946|ref|YP_008577783.1| ribosomal protein S8 (chloroplast) [Corymbia eximia] gi|545719032|ref|YP_008577868.1| ribosomal protein S8 (chloroplast) [Corymbia tessellaris] gi|545719118|ref|YP_008577953.1| ribosomal protein S8 (chloroplast) [Angophora floribunda] gi|545719204|ref|YP_008578038.1| ribosomal protein S8 (chloroplast) [Angophora costata] gi|146335783|sp|Q49KW3.1|RR8_EUCGG RecName: Full=30S ribosomal protein S8, chloroplastic gi|60460842|gb|AAX21062.1| ribosomal protein S8 [Eucalyptus globulus subsp. globulus] gi|308223315|gb|ADO23623.1| ribosomal protein S8 [Eucalyptus grandis] gi|442566188|gb|AGC56387.1| ribosomal protein S8 (chloroplast) [Eucalyptus obliqua] gi|442566274|gb|AGC56472.1| ribosomal protein S8 (chloroplast) [Eucalyptus radiata] gi|442566360|gb|AGC56557.1| ribosomal protein S8 (chloroplast) [Eucalyptus delegatensis] gi|442566446|gb|AGC56642.1| ribosomal protein S8 (chloroplast) [Eucalyptus verrucata] gi|442566532|gb|AGC56727.1| ribosomal protein S8 (chloroplast) [Eucalyptus baxteri] gi|442566618|gb|AGC56812.1| ribosomal protein S8 (chloroplast) [Eucalyptus diversifolia] gi|442566962|gb|AGC57152.1| ribosomal protein S8 (chloroplast) [Eucalyptus umbra] gi|442567048|gb|AGC57237.1| ribosomal protein S8 (chloroplast) [Eucalyptus cloeziana] gi|442567134|gb|AGC57322.1| ribosomal protein S8 (chloroplast) [Eucalyptus patens] gi|442567220|gb|AGC57407.1| ribosomal protein S8 (chloroplast) [Eucalyptus marginata] gi|442567306|gb|AGC57492.1| ribosomal protein S8 (chloroplast) [Eucalyptus curtisii] gi|442567392|gb|AGC57577.1| ribosomal protein S8 (chloroplast) [Eucalyptus melliodora] gi|442567478|gb|AGC57662.1| ribosomal protein S8 (chloroplast) [Eucalyptus melliodora] gi|442567564|gb|AGC57747.1| ribosomal protein S8 (chloroplast) [Eucalyptus polybractea] gi|442567650|gb|AGC57832.1| ribosomal protein S8 (chloroplast) [Eucalyptus cladocalyx] gi|442567736|gb|AGC57917.1| ribosomal protein S8 (chloroplast) [Eucalyptus globulus] gi|442567822|gb|AGC58002.1| ribosomal protein S8 (chloroplast) [Eucalyptus nitens] gi|442567908|gb|AGC58087.1| ribosomal protein S8 (chloroplast) [Eucalyptus aromaphloia] gi|442567994|gb|AGC58172.1| ribosomal protein S8 (chloroplast) [Eucalyptus saligna] gi|442568080|gb|AGC58257.1| ribosomal protein S8 (chloroplast) [Eucalyptus camaldulensis] gi|442568166|gb|AGC58342.1| ribosomal protein S8 (chloroplast) [Eucalyptus deglupta] gi|442568252|gb|AGC58427.1| ribosomal protein S8 (chloroplast) [Eucalyptus spathulata] gi|442568338|gb|AGC58512.1| ribosomal protein S8 (chloroplast) [Eucalyptus torquata] gi|442568424|gb|AGC58597.1| ribosomal protein S8 (chloroplast) [Eucalyptus diversicolor] gi|442568510|gb|AGC58682.1| ribosomal protein S8 (chloroplast) [Eucalyptus salmonophloia] gi|442568682|gb|AGC58852.1| ribosomal protein S8 (chloroplast) [Eucalyptus guilfoylei] gi|442568854|gb|AGC59022.1| ribosomal protein S8 (chloroplast) [Corymbia gummifera] gi|442568940|gb|AGC59107.1| ribosomal protein S8 (chloroplast) [Corymbia maculata] gi|442569026|gb|AGC59192.1| ribosomal protein S8 (chloroplast) [Corymbia eximia] gi|442569112|gb|AGC59277.1| ribosomal protein S8 (chloroplast) [Corymbia tessellaris] gi|442569198|gb|AGC59362.1| ribosomal protein S8 (chloroplast) [Angophora floribunda] gi|442569284|gb|AGC59447.1| ribosomal protein S8 (chloroplast) [Angophora costata] Length = 134 Score = 160 bits (404), Expect = 2e-37 Identities = 80/85 (94%), Positives = 82/85 (96%), Gaps = 2/85 (2%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTIL--KRISRPGLRIYSNYQRIPRILGGMGIVILS 134 KH+E+NK FLVLTLRHRRNRKGPYRTIL KRISRPGLRIYSNYQRIPRILGGMGIVILS Sbjct: 50 KHQENNKYFLVLTLRHRRNRKGPYRTILNLKRISRPGLRIYSNYQRIPRILGGMGIVILS 109 Query: 133 TSRGIMTDREARLEGIGGEILCYIW 59 TSRGIMTDREARLEGIGGEILCYIW Sbjct: 110 TSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_004021351.1| ribosomal protein S8 [Theobroma cacao] gi|309321301|gb|ADO64844.1| ribosomal protein S8 [Theobroma cacao] gi|328924814|gb|ADO64925.2| ribosomal protein S8 [Theobroma cacao] gi|371925971|gb|AEX57761.1| ribosomal protein S8 (chloroplast) [Theobroma cacao] gi|371926053|gb|AEX57842.1| ribosomal protein S8 (chloroplast) [Theobroma cacao] gi|371926135|gb|AEX57923.1| ribosomal protein S8 (chloroplast) [Theobroma cacao] gi|371926217|gb|AEX58004.1| ribosomal protein S8 (chloroplast) [Theobroma cacao] gi|371926299|gb|AEX58085.1| ribosomal protein S8 (chloroplast) [Theobroma cacao] gi|371926381|gb|AEX58166.1| ribosomal protein S8 (chloroplast) [Theobroma cacao] gi|371926463|gb|AEX58247.1| ribosomal protein S8 (chloroplast) [Theobroma cacao] gi|371926545|gb|AEX58328.1| ribosomal protein S8 (chloroplast) [Theobroma cacao] gi|371926627|gb|AEX58409.1| ribosomal protein S8 (chloroplast) [Theobroma cacao] gi|371926791|gb|AEX58571.1| ribosomal protein S8 (chloroplast) [Theobroma cacao] Length = 134 Score = 160 bits (404), Expect = 2e-37 Identities = 80/85 (94%), Positives = 82/85 (96%), Gaps = 2/85 (2%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTIL--KRISRPGLRIYSNYQRIPRILGGMGIVILS 134 KHRESNK FLVLTLRHRRNRKGPYRTIL +RISRPGLRIYSNYQ+IPRILGGMGIVILS Sbjct: 50 KHRESNKYFLVLTLRHRRNRKGPYRTILNLRRISRPGLRIYSNYQQIPRILGGMGIVILS 109 Query: 133 TSRGIMTDREARLEGIGGEILCYIW 59 TSRGIMTDREARLEGIGGEILCYIW Sbjct: 110 TSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_008993470.1| ribosomal protein S8 (chloroplast) [Magnolia kobus] Length = 132 Score = 159 bits (403), Expect = 3e-37 Identities = 77/83 (92%), Positives = 80/83 (96%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 128 KHRE+NK+FLV TLRHRRNRKG YR ILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS Sbjct: 50 KHRENNKSFLVSTLRHRRNRKGTYRLILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 109 Query: 127 RGIMTDREARLEGIGGEILCYIW 59 RGIMTDREARLEGIGGE+LCYIW Sbjct: 110 RGIMTDREARLEGIGGEVLCYIW 132 >ref|YP_740601.1| ribosomal protein S8 [Platanus occidentalis] gi|122166002|sp|Q09G10.1|RR8_PLAOC RecName: Full=30S ribosomal protein S8, chloroplastic gi|114054421|gb|ABI49815.1| ribosomal protein S8 [Platanus occidentalis] Length = 132 Score = 159 bits (403), Expect = 3e-37 Identities = 78/83 (93%), Positives = 80/83 (96%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 128 KHRESNK FLV TLRHRRNRK PY+TILKRISRPGLRIYSNYQRIPRILGG+GIVILSTS Sbjct: 50 KHRESNKYFLVSTLRHRRNRKRPYKTILKRISRPGLRIYSNYQRIPRILGGIGIVILSTS 109 Query: 127 RGIMTDREARLEGIGGEILCYIW 59 RGIMTDREARLEGIGGEILCYIW Sbjct: 110 RGIMTDREARLEGIGGEILCYIW 132 >ref|YP_001294134.1| ribosomal protein S8 [Chloranthus spicatus] gi|158706199|sp|A6MMF8.1|RR8_CHLSC RecName: Full=30S ribosomal protein S8, chloroplastic gi|146744223|gb|ABQ43295.1| ribosomal protein S8 [Chloranthus spicatus] Length = 134 Score = 159 bits (402), Expect = 4e-37 Identities = 78/83 (93%), Positives = 79/83 (95%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 128 KHRE+NK FLV TLRHRRNRKG YR ILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS Sbjct: 52 KHRENNKYFLVSTLRHRRNRKGAYRNILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 111 Query: 127 RGIMTDREARLEGIGGEILCYIW 59 RGIMTDREARLEGIGGEILCYIW Sbjct: 112 RGIMTDREARLEGIGGEILCYIW 134 >ref|YP_008993814.1| ribosomal protein S8 (chloroplast) [Magnolia sinica] Length = 132 Score = 159 bits (401), Expect = 5e-37 Identities = 77/83 (92%), Positives = 79/83 (95%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 128 KHRE+NK FLV TLRHRRNRKG YR ILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS Sbjct: 50 KHRENNKYFLVSTLRHRRNRKGTYRNILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 109 Query: 127 RGIMTDREARLEGIGGEILCYIW 59 RGIMTDREARLEGIGGE+LCYIW Sbjct: 110 RGIMTDREARLEGIGGEVLCYIW 132 >ref|YP_008993384.1| ribosomal protein S8 (chloroplast) [Magnolia pyramidata] Length = 132 Score = 159 bits (401), Expect = 5e-37 Identities = 77/83 (92%), Positives = 79/83 (95%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 128 KHRE+NK FLV TLRHRRNRKG YR ILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS Sbjct: 50 KHRENNKYFLVSTLRHRRNRKGTYRNILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 109 Query: 127 RGIMTDREARLEGIGGEILCYIW 59 RGIMTDREARLEGIGGE+LCYIW Sbjct: 110 RGIMTDREARLEGIGGEVLCYIW 132 >ref|YP_004769750.1| ribosomal protein S8 [Magnolia kwangsiensis] gi|400256623|ref|YP_006576150.1| ribosomal protein S8 (chloroplast) [Magnolia denudata] gi|452848892|ref|YP_007474572.1| ribosomal protein S8 (chloroplast) [Magnolia grandiflora] gi|570759787|ref|YP_008993212.1| ribosomal protein S8 (chloroplast) [Magnolia cathcartii] gi|570760135|ref|YP_008993556.1| ribosomal protein S8 (chloroplast) [Magnolia liliifera] gi|570760222|ref|YP_008993642.1| ribosomal protein S8 (chloroplast) [Magnolia odora] gi|570772330|ref|YP_008993900.1| ribosomal protein S8 (chloroplast) [Magnolia sprengeri] gi|573972410|ref|YP_008993728.1| ribosomal protein S8 (chloroplast) [Magnolia salicifolia] gi|112296175|gb|ABI15124.1| ribosomal protein S8 (chloroplast) [Magnolia acuminata] gi|302424216|gb|ADL39092.1| ribosomal protein S8 [Magnolia kwangsiensis] gi|343887574|gb|AEM65253.1| ribosomal protein S8 [Magnolia denudata] gi|372862203|gb|AEX98287.1| ribosomal protein S8 (chloroplast) [Magnolia liliiflora] gi|372862287|gb|AEX98370.1| ribosomal protein S8 (chloroplast) [Magnolia denudata] gi|372862879|gb|AEX98955.1| ribosomal protein S8 (chloroplast) [Magnolia grandiflora] gi|372863049|gb|AEX99123.1| ribosomal protein S8 (chloroplast) [Magnolia grandiflora] Length = 132 Score = 159 bits (401), Expect = 5e-37 Identities = 77/83 (92%), Positives = 79/83 (95%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 128 KHRE+NK FLV TLRHRRNRKG YR ILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS Sbjct: 50 KHRENNKYFLVSTLRHRRNRKGTYRNILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 109 Query: 127 RGIMTDREARLEGIGGEILCYIW 59 RGIMTDREARLEGIGGE+LCYIW Sbjct: 110 RGIMTDREARLEGIGGEVLCYIW 132 >ref|YP_740238.1| ribosomal protein S8 [Liriodendron tulipifera] gi|122227466|sp|Q0G9I3.1|RR8_LIRTU RecName: Full=30S ribosomal protein S8, chloroplastic gi|112296171|gb|ABI15122.1| ribosomal protein S8 (chloroplast) [Liriodendron tulipifera] gi|113201030|gb|ABI32545.1| ribosomal protein S8 [Liriodendron tulipifera] Length = 132 Score = 159 bits (401), Expect = 5e-37 Identities = 77/83 (92%), Positives = 79/83 (95%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 128 KHRE+NK FLV TLRHRRNRKG YR ILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS Sbjct: 50 KHRENNKYFLVSTLRHRRNRKGTYRNILKRISRPGLRIYSNYQRIPRILGGMGIVILSTS 109 Query: 127 RGIMTDREARLEGIGGEILCYIW 59 RGIMTDREARLEGIGGE+LCYIW Sbjct: 110 RGIMTDREARLEGIGGEVLCYIW 132 >ref|YP_004842273.1| ribosomal protein S8 [Pyrus pyrifolia] gi|568246765|ref|YP_008965527.1| ribosomal protein S8 [Pyrus spinosa] gi|345433595|dbj|BAK69417.1| ribosomal protein S8 [Pyrus pyrifolia] gi|565666499|emb|CDI73599.1| ribosomal protein S8 [Pyrus spinosa] Length = 134 Score = 158 bits (400), Expect = 6e-37 Identities = 77/85 (90%), Positives = 82/85 (96%), Gaps = 2/85 (2%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTIL--KRISRPGLRIYSNYQRIPRILGGMGIVILS 134 KH+ESNK FLVLTLRHRRNRKGPYRT+L KRISRPGLRIYSNYQRIPRILGGMG+VILS Sbjct: 50 KHQESNKYFLVLTLRHRRNRKGPYRTVLNLKRISRPGLRIYSNYQRIPRILGGMGVVILS 109 Query: 133 TSRGIMTDREARLEGIGGEILCYIW 59 TSRGIMTDR+ARLEGIGGE+LCYIW Sbjct: 110 TSRGIMTDRKARLEGIGGEVLCYIW 134 >gb|ADZ54489.1| ribosomal protein S8 [Portulaca cryptopetala] Length = 134 Score = 158 bits (400), Expect = 6e-37 Identities = 78/85 (91%), Positives = 80/85 (94%), Gaps = 2/85 (2%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTIL--KRISRPGLRIYSNYQRIPRILGGMGIVILS 134 KH+E NKNFLVLTLRHRRNRKGPYR L KR+SRPGLRIYSNYQRIPRILGGMGIVILS Sbjct: 50 KHQEGNKNFLVLTLRHRRNRKGPYRNTLNLKRVSRPGLRIYSNYQRIPRILGGMGIVILS 109 Query: 133 TSRGIMTDREARLEGIGGEILCYIW 59 TSRGIMTDREARLEGIGGEILCYIW Sbjct: 110 TSRGIMTDREARLEGIGGEILCYIW 134 >gb|ADD29882.1| ribosomal protein S8 [Heuchera sanguinea] Length = 134 Score = 158 bits (400), Expect = 6e-37 Identities = 78/85 (91%), Positives = 83/85 (97%), Gaps = 2/85 (2%) Frame = -2 Query: 307 KHRESNKNFLVLTLRHRRNRKGPYRTIL--KRISRPGLRIYSNYQRIPRILGGMGIVILS 134 KHRE+NK+FLVLTL+HRRNRKGPY+TIL KRISRPGLRIYSNYQRIPRILGG+GIVILS Sbjct: 50 KHRENNKDFLVLTLQHRRNRKGPYKTILNLKRISRPGLRIYSNYQRIPRILGGVGIVILS 109 Query: 133 TSRGIMTDREARLEGIGGEILCYIW 59 TSRGIMTDREARLEGIGGEILCYIW Sbjct: 110 TSRGIMTDREARLEGIGGEILCYIW 134