BLASTX nr result
ID: Akebia25_contig00039131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00039131 (200 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004302894.1| PREDICTED: homeobox-leucine zipper protein G... 90 4e-16 ref|XP_007217160.1| hypothetical protein PRUPE_ppa001840mg [Prun... 90 4e-16 gb|ADL36724.1| HD domain class transcription factor [Malus domes... 90 4e-16 ref|XP_006833329.1| hypothetical protein AMTR_s00109p00072520 [A... 89 5e-16 ref|XP_004173547.1| PREDICTED: homeobox-leucine zipper protein G... 89 6e-16 ref|XP_004151038.1| PREDICTED: homeobox-leucine zipper protein G... 89 6e-16 ref|XP_006465622.1| PREDICTED: homeobox-leucine zipper protein G... 88 1e-15 ref|XP_007135673.1| hypothetical protein PHAVU_010G148700g [Phas... 88 1e-15 ref|XP_006426950.1| hypothetical protein CICLE_v10024950mg [Citr... 88 1e-15 ref|XP_002304207.2| GLABRA 2 family protein [Populus trichocarpa... 88 1e-15 ref|XP_007024190.1| HD-ZIP IV family of homeobox-leucine zipper ... 88 1e-15 ref|XP_007024189.1| HD-ZIP IV family of homeobox-leucine zipper ... 88 1e-15 emb|CBI36129.3| unnamed protein product [Vitis vinifera] 88 1e-15 ref|XP_002284502.1| PREDICTED: homeobox-leucine zipper protein G... 88 1e-15 ref|XP_002516023.1| homeobox protein, putative [Ricinus communis... 88 1e-15 ref|XP_002299713.1| GLABRA 2 family protein [Populus trichocarpa... 88 1e-15 gb|EXB74519.1| Homeobox-leucine zipper protein GLABRA 2 [Morus n... 87 3e-15 ref|XP_006585590.1| PREDICTED: homeobox-leucine zipper protein G... 87 3e-15 ref|XP_007150635.1| hypothetical protein PHAVU_005G168900g [Phas... 87 3e-15 gb|AAK19610.1|AF336277_1 BNLGHi8377 [Gossypium hirsutum] 87 3e-15 >ref|XP_004302894.1| PREDICTED: homeobox-leucine zipper protein GLABRA 2-like [Fragaria vesca subsp. vesca] Length = 764 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHTTEQIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 112 YHRHTTEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 155 >ref|XP_007217160.1| hypothetical protein PRUPE_ppa001840mg [Prunus persica] gi|462413310|gb|EMJ18359.1| hypothetical protein PRUPE_ppa001840mg [Prunus persica] Length = 757 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHTTEQIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 107 YHRHTTEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 150 >gb|ADL36724.1| HD domain class transcription factor [Malus domestica] Length = 761 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHTTEQIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 110 YHRHTTEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 153 >ref|XP_006833329.1| hypothetical protein AMTR_s00109p00072520 [Amborella trichopoda] gi|548838005|gb|ERM98607.1| hypothetical protein AMTR_s00109p00072520 [Amborella trichopoda] Length = 751 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHT EQIREME LF+DSPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 102 YHRHTAEQIREMEALFKDSPHPDEKQRQQLSKQLGLAPRQVKFW 145 >ref|XP_004173547.1| PREDICTED: homeobox-leucine zipper protein GLABRA 2-like, partial [Cucumis sativus] Length = 365 Score = 89.0 bits (219), Expect = 6e-16 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHTTEQIREME LF++SPHPDEKQRQQ+SK+LGL+PRQVKFW Sbjct: 116 YHRHTTEQIREMEALFKESPHPDEKQRQQLSKRLGLSPRQVKFW 159 >ref|XP_004151038.1| PREDICTED: homeobox-leucine zipper protein GLABRA 2-like [Cucumis sativus] Length = 777 Score = 89.0 bits (219), Expect = 6e-16 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHTTEQIREME LF++SPHPDEKQRQQ+SK+LGL+PRQVKFW Sbjct: 112 YHRHTTEQIREMEALFKESPHPDEKQRQQLSKRLGLSPRQVKFW 155 >ref|XP_006465622.1| PREDICTED: homeobox-leucine zipper protein GLABRA 2-like [Citrus sinensis] Length = 764 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHT EQIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 113 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 156 >ref|XP_007135673.1| hypothetical protein PHAVU_010G148700g [Phaseolus vulgaris] gi|561008718|gb|ESW07667.1| hypothetical protein PHAVU_010G148700g [Phaseolus vulgaris] Length = 748 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHT EQIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 99 YHRHTVEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 142 >ref|XP_006426950.1| hypothetical protein CICLE_v10024950mg [Citrus clementina] gi|557528940|gb|ESR40190.1| hypothetical protein CICLE_v10024950mg [Citrus clementina] Length = 764 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHT EQIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 113 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 156 >ref|XP_002304207.2| GLABRA 2 family protein [Populus trichocarpa] gi|550342441|gb|EEE79186.2| GLABRA 2 family protein [Populus trichocarpa] Length = 759 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHT EQIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 109 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 152 >ref|XP_007024190.1| HD-ZIP IV family of homeobox-leucine zipper protein with lipid-binding START domain isoform 2, partial [Theobroma cacao] gi|508779556|gb|EOY26812.1| HD-ZIP IV family of homeobox-leucine zipper protein with lipid-binding START domain isoform 2, partial [Theobroma cacao] Length = 597 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHT EQIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 101 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 144 >ref|XP_007024189.1| HD-ZIP IV family of homeobox-leucine zipper protein with lipid-binding START domain isoform 1 [Theobroma cacao] gi|508779555|gb|EOY26811.1| HD-ZIP IV family of homeobox-leucine zipper protein with lipid-binding START domain isoform 1 [Theobroma cacao] Length = 753 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHT EQIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 101 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 144 >emb|CBI36129.3| unnamed protein product [Vitis vinifera] Length = 750 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHT EQIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 98 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 141 >ref|XP_002284502.1| PREDICTED: homeobox-leucine zipper protein GLABRA 2-like [Vitis vinifera] Length = 754 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHT EQIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 102 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 145 >ref|XP_002516023.1| homeobox protein, putative [Ricinus communis] gi|223544928|gb|EEF46443.1| homeobox protein, putative [Ricinus communis] Length = 758 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHT EQIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 109 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 152 >ref|XP_002299713.1| GLABRA 2 family protein [Populus trichocarpa] gi|222846971|gb|EEE84518.1| GLABRA 2 family protein [Populus trichocarpa] Length = 761 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHT EQIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 106 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 149 >gb|EXB74519.1| Homeobox-leucine zipper protein GLABRA 2 [Morus notabilis] Length = 755 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHT +QIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 104 YHRHTADQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 147 >ref|XP_006585590.1| PREDICTED: homeobox-leucine zipper protein GLABRA 2-like isoform X2 [Glycine max] Length = 616 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/44 (84%), Positives = 43/44 (97%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHTTEQIREME LF++SPHPDEKQRQ++S++LGLAPRQVKFW Sbjct: 96 YHRHTTEQIREMEALFKESPHPDEKQRQKLSQQLGLAPRQVKFW 139 >ref|XP_007150635.1| hypothetical protein PHAVU_005G168900g [Phaseolus vulgaris] gi|561023899|gb|ESW22629.1| hypothetical protein PHAVU_005G168900g [Phaseolus vulgaris] Length = 758 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHT +QIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 108 YHRHTADQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 151 >gb|AAK19610.1|AF336277_1 BNLGHi8377 [Gossypium hirsutum] Length = 758 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +3 Query: 69 YHRHTTEQIREMETLFRDSPHPDEKQRQQISKKLGLAPRQVKFW 200 YHRHT +QIREME LF++SPHPDEKQRQQ+SK+LGLAPRQVKFW Sbjct: 106 YHRHTADQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFW 149