BLASTX nr result
ID: Akebia25_contig00039097
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00039097 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F... 96 4e-18 gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis A... 96 4e-18 gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botry... 96 4e-18 gb|EMC91116.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia... 96 4e-18 gb|ELR02139.1| 40S ribosomal protein S28 [Pseudogymnoascus destr... 96 4e-18 ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria trit... 96 4e-18 ref|XP_001561242.1| 40S ribosomal protein S28 [Botryotinia fucke... 96 4e-18 ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [... 94 2e-17 gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina M... 94 2e-17 ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fi... 94 2e-17 ref|XP_381438.1| hypothetical protein FG01262.1 [Fusarium gramin... 94 2e-17 gb|ERS99836.1| 40S ribosomal protein S28 [Sporothrix schenckii A... 94 2e-17 gb|EQB45990.1| ThiS family protein [Colletotrichum gloeosporioid... 94 2e-17 emb|CCT62031.1| related to ribosomal protein S28B [Fusarium fuji... 94 2e-17 ref|XP_007277800.1| ribosomal protein s28e [Colletotrichum gloeo... 94 2e-17 emb|CCE33319.1| probable ribosomal protein S28B [Claviceps purpu... 94 2e-17 gb|EKJ79388.1| hypothetical protein FPSE_00430 [Fusarium pseudog... 94 2e-17 gb|EGU89241.1| hypothetical protein FOXB_00194 [Fusarium oxyspor... 94 2e-17 ref|XP_006964314.1| ribosomal protein S28 [Trichoderma reesei QM... 94 2e-17 gb|EFQ35236.1| ribosomal protein S28e [Colletotrichum graminicol... 94 2e-17 >gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F-4157] Length = 68 Score = 96.3 bits (238), Expect = 4e-18 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] Length = 68 Score = 96.3 bits (238), Expect = 4e-18 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botryotinia fuckeliana BcDW1] Length = 114 Score = 96.3 bits (238), Expect = 4e-18 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPV+EDDILC Sbjct: 55 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 102 >gb|EMC91116.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia compniacensis UAMH 10762] Length = 68 Score = 96.3 bits (238), Expect = 4e-18 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >gb|ELR02139.1| 40S ribosomal protein S28 [Pseudogymnoascus destructans 20631-21] Length = 68 Score = 96.3 bits (238), Expect = 4e-18 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria tritici IPO323] gi|339470532|gb|EGP85629.1| hypothetical protein MYCGRDRAFT_81501 [Zymoseptoria tritici IPO323] gi|452980191|gb|EME79952.1| hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] Length = 68 Score = 96.3 bits (238), Expect = 4e-18 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >ref|XP_001561242.1| 40S ribosomal protein S28 [Botryotinia fuckeliana B05.10] gi|347829972|emb|CCD45669.1| hypothetical protein BofuT4P34000010001 [Botryotinia fuckeliana T4] Length = 68 Score = 96.3 bits (238), Expect = 4e-18 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|615415585|ref|XP_007584949.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485922014|gb|EOD47615.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485925270|gb|EOD49893.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] Length = 68 Score = 94.4 bits (233), Expect = 2e-17 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPV+E+DILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina MS6] gi|407924574|gb|EKG17607.1| Histone core [Macrophomina phaseolina MS6] Length = 68 Score = 94.4 bits (233), Expect = 2e-17 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPV+E+DILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] gi|588893325|gb|EXF75473.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] Length = 68 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDETRSIIRNVKGPVREDDILC 56 >ref|XP_381438.1| hypothetical protein FG01262.1 [Fusarium graminearum PH-1] Length = 171 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|ERS99836.1| 40S ribosomal protein S28 [Sporothrix schenckii ATCC 58251] Length = 68 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|EQB45990.1| ThiS family protein [Colletotrichum gloeosporioides Cg-14] Length = 162 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >emb|CCT62031.1| related to ribosomal protein S28B [Fusarium fujikuroi IMI 58289] Length = 166 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >ref|XP_007277800.1| ribosomal protein s28e [Colletotrichum gloeosporioides Nara gc5] gi|429858281|gb|ELA33106.1| ribosomal protein s28e [Colletotrichum gloeosporioides Nara gc5] Length = 68 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >emb|CCE33319.1| probable ribosomal protein S28B [Claviceps purpurea 20.1] gi|500256292|gb|EON99563.1| putative 40s ribosomal protein s28 protein [Togninia minima UCRPA7] gi|594720915|gb|EXV03803.1| ribosomal protein S28e [Metarhizium robertsii] Length = 68 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|EKJ79388.1| hypothetical protein FPSE_00430 [Fusarium pseudograminearum CS3096] Length = 165 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|EGU89241.1| hypothetical protein FOXB_00194 [Fusarium oxysporum Fo5176] gi|475668887|gb|EMT66673.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. cubense race 4] gi|477507310|gb|ENH60604.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. cubense race 1] gi|558856474|gb|ESU06557.1| hypothetical protein FGSG_11922 [Fusarium graminearum PH-1] gi|584128624|gb|EWG38043.1| 40S ribosomal protein S28 [Fusarium verticillioides 7600] gi|584128625|gb|EWG38044.1| 40S ribosomal protein S28 [Fusarium verticillioides 7600] gi|587672262|gb|EWY94603.1| 40S ribosomal protein S28 [Fusarium oxysporum FOSC 3-a] gi|587703480|gb|EWZ50085.1| 40S ribosomal protein S28 [Fusarium oxysporum Fo47] gi|587717137|gb|EWZ88474.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587756069|gb|EXA53785.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. pisi HDV247] gi|590045476|gb|EXK47334.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. melonis 26406] gi|590061735|gb|EXK89259.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. raphani 54005] gi|591413909|gb|EXL49046.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591443426|gb|EXL75989.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591443427|gb|EXL75990.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591479470|gb|EXM10530.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591499163|gb|EXM28601.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|596543630|gb|EYB23918.1| hypothetical protein FG05_11922 [Fusarium graminearum] Length = 68 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >ref|XP_006964314.1| ribosomal protein S28 [Trichoderma reesei QM6a] gi|340519752|gb|EGR49990.1| ribosomal protein S28 [Trichoderma reesei QM6a] gi|358385084|gb|EHK22681.1| hypothetical protein TRIVIDRAFT_91439 [Trichoderma virens Gv29-8] gi|358393391|gb|EHK42792.1| hypothetical protein TRIATDRAFT_300838 [Trichoderma atroviride IMI 206040] gi|572280322|gb|ETS03419.1| ribosomal protein S28e [Trichoderma reesei RUT C-30] Length = 69 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPV+EDDILC Sbjct: 10 KLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 57 >gb|EFQ35236.1| ribosomal protein S28e [Colletotrichum graminicola M1.001] gi|380474013|emb|CCF46007.1| 40S ribosomal protein S28 [Colletotrichum higginsianum] gi|573067571|gb|ETS87099.1| 40S ribosomal protein S28 [Pestalotiopsis fici W106-1] Length = 68 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 330 KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVKEDDILC 187 KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPV+EDDILC Sbjct: 9 KLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56