BLASTX nr result
ID: Akebia25_contig00038881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00038881 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERF72645.1| hypothetical protein EPUS_05699 [Endocarpon pusil... 56 5e-06 gb|EON63497.1| hypothetical protein W97_02725 [Coniosporium apol... 56 5e-06 >gb|ERF72645.1| hypothetical protein EPUS_05699 [Endocarpon pusillum Z07020] Length = 759 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/36 (69%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +2 Query: 83 PYQNISNAFD-FDPMLDADPFGLSASMHFPTNYSFD 187 P+ + ++AFD +DPMLDADPFGLSASMHFPT Y++D Sbjct: 333 PFASGNHAFDPYDPMLDADPFGLSASMHFPTPYTYD 368 >gb|EON63497.1| hypothetical protein W97_02725 [Coniosporium apollinis CBS 100218] Length = 357 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +2 Query: 29 NGASKISFADGVQPDENAPYQNISNAFD-FDPMLDADPFGLSASMHFPTNYSFD 187 N A +I A G +P ++A + + FD +D MLDADPFGL+ASMHFPT +S++ Sbjct: 302 NIAQQIHAAAGGRPADHANFGGVPQMFDAYDSMLDADPFGLTASMHFPTQFSYE 355