BLASTX nr result
ID: Akebia25_contig00038815
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00038815 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EUC67120.1| 40S ribosomal protein S27 [Rhizoctonia solani AG-... 67 3e-09 emb|CCO26109.1| 40S ribosomal protein S27 [Rhizoctonia solani AG... 67 3e-09 ref|XP_007378532.1| 40S ribosomal protein S27 [Punctularia strig... 67 3e-09 gb|EMC98021.1| hypothetical protein BAUCODRAFT_32024, partial [B... 67 3e-09 ref|XP_003847709.1| 40S ribosomal protein S27 [Zymoseptoria trit... 67 3e-09 ref|XP_001828417.1| 40S ribosomal protein S27 [Coprinopsis ciner... 67 3e-09 emb|CCX29534.1| Similar to 40S ribosomal protein S27; acc. no. Q... 66 4e-09 ref|XP_007587859.1| putative 40s ribosomal protein s27 protein [... 66 4e-09 gb|EKG11584.1| Ribosomal protein S27e [Macrophomina phaseolina MS6] 66 4e-09 ref|XP_007336756.1| ribosomal protein S27 [Auricularia delicata ... 66 4e-09 ref|XP_002839823.1| 40S ribosomal protein S27 [Tuber melanosporu... 66 4e-09 ref|XP_007411417.1| hypothetical protein MELLADRAFT_87975 [Melam... 65 7e-09 ref|XP_003332938.1| 40S ribosomal protein S27 [Puccinia graminis... 65 7e-09 ref|XP_001874254.1| 40S ribosomal protein S27 [Laccaria bicolor ... 65 7e-09 ref|XP_662381.1| RS27_XENLA 40S ribosomal protein S27 [Aspergill... 65 7e-09 gb|ESK98476.1| 40s ribosomal protein s27 [Moniliophthora roreri ... 65 1e-08 gb|EPS42565.1| hypothetical protein H072_3382 [Dactylellina hapt... 65 1e-08 gb|EPQ28895.1| hypothetical protein PFL1_03696 [Pseudozyma flocc... 65 1e-08 gb|EME38718.1| zinc-binding ribosomal protein S27e-like protein ... 65 1e-08 gb|EGX49037.1| hypothetical protein AOL_s00079g258 [Arthrobotrys... 65 1e-08 >gb|EUC67120.1| 40S ribosomal protein S27 [Rhizoctonia solani AG-3 Rhs1AP] Length = 83 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVV+CSSCA VLCQPTGGK RLTEGCSFRRK Sbjct: 50 AQTVVMCSSCATVLCQPTGGKARLTEGCSFRRK 82 >emb|CCO26109.1| 40S ribosomal protein S27 [Rhizoctonia solani AG-1 IB] Length = 83 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVV+CSSCA VLCQPTGGK RLTEGCSFRRK Sbjct: 50 AQTVVMCSSCATVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_007378532.1| 40S ribosomal protein S27 [Punctularia strigosozonata HHB-11173 SS5] gi|390604224|gb|EIN13615.1| 40S ribosomal protein S27 [Punctularia strigosozonata HHB-11173 SS5] Length = 83 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRKT 189 AQTVV+C SCA VLCQPTGGK RLTEGCSFRRK+ Sbjct: 50 AQTVVICGSCASVLCQPTGGKARLTEGCSFRRKS 83 >gb|EMC98021.1| hypothetical protein BAUCODRAFT_32024, partial [Baudoinia compniacensis UAMH 10762] Length = 81 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVVVC+ C+QVLCQPTGGK RLTEGCSFRRK Sbjct: 49 AQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 81 >ref|XP_003847709.1| 40S ribosomal protein S27 [Zymoseptoria tritici IPO323] gi|339467582|gb|EGP82685.1| hypothetical protein MYCGRDRAFT_64763 [Zymoseptoria tritici IPO323] gi|452986834|gb|EME86590.1| hypothetical protein MYCFIDRAFT_210543 [Pseudocercospora fijiensis CIRAD86] gi|453079947|gb|EMF07999.1| 40S ribosomal protein S27 [Sphaerulina musiva SO2202] Length = 82 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVVVC+ C+QVLCQPTGGK RLTEGCSFRRK Sbjct: 50 AQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_001828417.1| 40S ribosomal protein S27 [Coprinopsis cinerea okayama7#130] gi|116510514|gb|EAU93409.1| ribosomal protein S27 [Coprinopsis cinerea okayama7#130] Length = 83 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVV+CSSC VLCQPTGGK RLTEGCSFRRK Sbjct: 50 AQTVVICSSCTSVLCQPTGGKARLTEGCSFRRK 82 >emb|CCX29534.1| Similar to 40S ribosomal protein S27; acc. no. Q7RVN2 [Pyronema omphalodes CBS 100304] Length = 82 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVV+C SCA VLCQPTGGK RLTEGCSFRRK Sbjct: 50 AQTVVICGSCATVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_007587859.1| putative 40s ribosomal protein s27 protein [Neofusicoccum parvum UCRNP2] gi|485917878|gb|EOD44675.1| putative 40s ribosomal protein s27 protein [Neofusicoccum parvum UCRNP2] Length = 82 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVVVC C+QVLCQPTGGK RLTEGCSFRRK Sbjct: 50 AQTVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >gb|EKG11584.1| Ribosomal protein S27e [Macrophomina phaseolina MS6] Length = 82 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVVVC C+QVLCQPTGGK RLTEGCSFRRK Sbjct: 50 AQTVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_007336756.1| ribosomal protein S27 [Auricularia delicata TFB-10046 SS5] gi|393247948|gb|EJD55455.1| ribosomal protein S27 [Auricularia delicata TFB-10046 SS5] Length = 83 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVV+C+SC QVLCQPTGGK RLTEGCS+RRK Sbjct: 50 AQTVVICASCTQVLCQPTGGKARLTEGCSYRRK 82 >ref|XP_002839823.1| 40S ribosomal protein S27 [Tuber melanosporum Mel28] gi|295636029|emb|CAZ84014.1| unnamed protein product [Tuber melanosporum] Length = 113 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVV+C SCA VLCQPTGGK RLTEGCSFRRK Sbjct: 81 AQTVVICGSCATVLCQPTGGKARLTEGCSFRRK 113 >ref|XP_007411417.1| hypothetical protein MELLADRAFT_87975 [Melampsora larici-populina 98AG31] gi|328856373|gb|EGG05495.1| hypothetical protein MELLADRAFT_87975 [Melampsora larici-populina 98AG31] Length = 83 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVV+C SCA VLCQPTGGK RLTEGCSFRRK Sbjct: 50 AQTVVLCGSCATVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_003332938.1| 40S ribosomal protein S27 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|331248947|ref|XP_003337094.1| 40S ribosomal protein S27 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|309311928|gb|EFP88519.1| small subunit ribosomal protein S27e [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|309316084|gb|EFP92675.1| small subunit ribosomal protein S27e [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 112 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVV+C SCA VLCQPTGGK RLTEGCSFRRK Sbjct: 79 AQTVVLCGSCATVLCQPTGGKARLTEGCSFRRK 111 >ref|XP_001874254.1| 40S ribosomal protein S27 [Laccaria bicolor S238N-H82] gi|164651806|gb|EDR16046.1| 40S ribosomal protein S27 [Laccaria bicolor S238N-H82] Length = 83 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVV+C+SC VLCQPTGGK RLTEGCSFRRK Sbjct: 50 AQTVVICASCTSVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_662381.1| RS27_XENLA 40S ribosomal protein S27 [Aspergillus nidulans FGSC A4] gi|40741157|gb|EAA60347.1| RS27_XENLA 40S ribosomal protein S27 [Aspergillus nidulans FGSC A4] gi|259482377|tpe|CBF76802.1| TPA: 40S ribosomal protein S27 (Broad) [Aspergillus nidulans FGSC A4] Length = 82 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVVVCS C+ VLCQPTGGK RLTEGCSFRRK Sbjct: 50 AQTVVVCSGCSTVLCQPTGGKARLTEGCSFRRK 82 >gb|ESK98476.1| 40s ribosomal protein s27 [Moniliophthora roreri MCA 2997] Length = 83 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVV+C SCA +LCQPTGGK RLTEGCSFR+K Sbjct: 50 AQTVVICGSCASILCQPTGGKARLTEGCSFRKK 82 >gb|EPS42565.1| hypothetical protein H072_3382 [Dactylellina haptotyla CBS 200.50] Length = 325 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVV+C SCA VLCQPTGGK RLTEGCSFR+K Sbjct: 293 AQTVVICGSCATVLCQPTGGKARLTEGCSFRKK 325 >gb|EPQ28895.1| hypothetical protein PFL1_03696 [Pseudozyma flocculosa PF-1] Length = 83 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVVVC SCAQVL QPTGGK RLTEGCSFRRK Sbjct: 50 AQTVVVCGSCAQVLSQPTGGKARLTEGCSFRRK 82 >gb|EME38718.1| zinc-binding ribosomal protein S27e-like protein [Dothistroma septosporum NZE10] Length = 82 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVV C+ C+QVLCQPTGGK RLTEGCSFRRK Sbjct: 50 AQTVVTCAGCSQVLCQPTGGKARLTEGCSFRRK 82 >gb|EGX49037.1| hypothetical protein AOL_s00079g258 [Arthrobotrys oligospora ATCC 24927] Length = 82 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 290 AQTVVVCSSCAQVLCQPTGGKGRLTEGCSFRRK 192 AQTVV+C SCA VLCQPTGGK RLTEGCSFR+K Sbjct: 50 AQTVVICGSCATVLCQPTGGKARLTEGCSFRKK 82