BLASTX nr result
ID: Akebia25_contig00038743
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00038743 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27710.3| unnamed protein product [Vitis vinifera] 62 8e-08 ref|XP_002270002.1| PREDICTED: uncharacterized protein LOC100242... 62 8e-08 ref|XP_002518022.1| hypothetical protein RCOM_1176900 [Ricinus c... 55 8e-06 >emb|CBI27710.3| unnamed protein product [Vitis vinifera] Length = 201 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 2 ENPNARETFISLKNERRLMWLQGKCNASSGCTV*G 106 ENPNARETFISLK+ERRL WLQGKC+ASSG V G Sbjct: 166 ENPNARETFISLKSERRLAWLQGKCSASSGSVVGG 200 >ref|XP_002270002.1| PREDICTED: uncharacterized protein LOC100242635 [Vitis vinifera] Length = 145 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 2 ENPNARETFISLKNERRLMWLQGKCNASSGCTV*G 106 ENPNARETFISLK+ERRL WLQGKC+ASSG V G Sbjct: 110 ENPNARETFISLKSERRLAWLQGKCSASSGSVVGG 144 >ref|XP_002518022.1| hypothetical protein RCOM_1176900 [Ricinus communis] gi|223543004|gb|EEF44540.1| hypothetical protein RCOM_1176900 [Ricinus communis] Length = 354 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 2 ENPNARETFISLKNERRLMWLQGKCNAS 85 ENPNARETFISLKNE+RL WLQGKC++S Sbjct: 108 ENPNARETFISLKNEKRLPWLQGKCSSS 135