BLASTX nr result
ID: Akebia25_contig00038217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00038217 (232 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOA83203.1| hypothetical protein SETTUDRAFT_164656 [Setosphae... 99 8e-19 gb|EMD63847.1| hypothetical protein COCSADRAFT_37597 [Bipolaris ... 99 8e-19 ref|XP_003298322.1| hypothetical protein PTT_08990 [Pyrenophora ... 98 1e-18 ref|XP_001939732.1| mitochondrial phosphate carrier protein [Pyr... 98 1e-18 gb|EKG11100.1| Mitochondrial substrate/solute carrier [Macrophom... 97 3e-18 gb|EUC41230.1| hypothetical protein COCMIDRAFT_106688 [Bipolaris... 96 4e-18 gb|EUC29120.1| hypothetical protein COCCADRAFT_107365 [Bipolaris... 96 4e-18 gb|EMD93043.1| hypothetical protein COCHEDRAFT_1193378 [Bipolari... 96 4e-18 gb|EME45318.1| hypothetical protein DOTSEDRAFT_71146 [Dothistrom... 95 9e-18 gb|EGX45644.1| hypothetical protein AOL_s00169g250 [Arthrobotrys... 95 9e-18 ref|XP_003840932.1| similar to mitochondrial phosphate carrier p... 95 9e-18 gb|EXJ89517.1| mitochondrial phosphate carrier protein 2 [Capron... 94 2e-17 gb|EWC47518.1| mitochondrial phosphate carrier protein 2 [Drechs... 94 2e-17 gb|ETN39374.1| hypothetical protein HMPREF1541_05597 [Cyphelloph... 94 3e-17 ref|XP_007589533.1| putative mitochondrial phosphate carrier pro... 94 3e-17 ref|XP_003868828.1| Pic2 protein [Candida orthopsilosis Co 90-12... 94 3e-17 ref|XP_755540.1| mitochondrial phosphate transporter Pic2 [Asper... 93 3e-17 gb|EHY58178.1| MC family mitochondrial carrier protein [Exophial... 93 3e-17 gb|EDP54718.1| mitochondrial phosphate transporter Pic2, putativ... 93 3e-17 ref|XP_001260668.1| mitochondrial phosphate carrier protein [Neo... 93 3e-17 >gb|EOA83203.1| hypothetical protein SETTUDRAFT_164656 [Setosphaeria turcica Et28A] Length = 308 Score = 98.6 bits (244), Expect = 8e-19 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 GKIGF+GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 264 GKIGFTGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >gb|EMD63847.1| hypothetical protein COCSADRAFT_37597 [Bipolaris sorokiniana ND90Pr] Length = 308 Score = 98.6 bits (244), Expect = 8e-19 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 GKIGF+GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 264 GKIGFTGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >ref|XP_003298322.1| hypothetical protein PTT_08990 [Pyrenophora teres f. teres 0-1] gi|311328556|gb|EFQ93588.1| hypothetical protein PTT_08990 [Pyrenophora teres f. teres 0-1] Length = 308 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 GKIGF GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 264 GKIGFPGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >ref|XP_001939732.1| mitochondrial phosphate carrier protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187975825|gb|EDU42451.1| mitochondrial phosphate carrier protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 308 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 GKIGF GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 264 GKIGFPGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >gb|EKG11100.1| Mitochondrial substrate/solute carrier [Macrophomina phaseolina MS6] Length = 309 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 G IGF+GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 265 GNIGFAGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 309 >gb|EUC41230.1| hypothetical protein COCMIDRAFT_106688 [Bipolaris oryzae ATCC 44560] Length = 308 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 229 KIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 KIGF+GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 265 KIGFTGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >gb|EUC29120.1| hypothetical protein COCCADRAFT_107365 [Bipolaris zeicola 26-R-13] gi|578485008|gb|EUN22515.1| hypothetical protein COCVIDRAFT_19770 [Bipolaris victoriae FI3] Length = 308 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 229 KIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 KIGF+GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 265 KIGFTGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >gb|EMD93043.1| hypothetical protein COCHEDRAFT_1193378 [Bipolaris maydis C5] gi|477587487|gb|ENI04568.1| hypothetical protein COCC4DRAFT_169749 [Bipolaris maydis ATCC 48331] Length = 308 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 229 KIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 KIGF+GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 265 KIGFTGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >gb|EME45318.1| hypothetical protein DOTSEDRAFT_71146 [Dothistroma septosporum NZE10] Length = 311 Score = 95.1 bits (235), Expect = 9e-18 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 G IGFSGLWNGLPVRI MIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 267 GNIGFSGLWNGLPVRIVMIGTLTAFQWLIYDSFKVYLGLPTTGGH 311 >gb|EGX45644.1| hypothetical protein AOL_s00169g250 [Arthrobotrys oligospora ATCC 24927] Length = 326 Score = 95.1 bits (235), Expect = 9e-18 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 G IGFSGLWNGLPVRI MIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 282 GNIGFSGLWNGLPVRIVMIGTLTAFQWLIYDSFKVYLGLPTTGGH 326 >ref|XP_003840932.1| similar to mitochondrial phosphate carrier protein [Leptosphaeria maculans JN3] gi|312217505|emb|CBX97453.1| similar to mitochondrial phosphate carrier protein [Leptosphaeria maculans JN3] Length = 304 Score = 95.1 bits (235), Expect = 9e-18 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 GKIGFSGLWNGL RIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 260 GKIGFSGLWNGLSTRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 304 >gb|EXJ89517.1| mitochondrial phosphate carrier protein 2 [Capronia epimyces CBS 606.96] Length = 283 Score = 94.0 bits (232), Expect = 2e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 G IGF+GLWNGLPVRI MIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 239 GNIGFAGLWNGLPVRIVMIGTLTAFQWLIYDSFKVYLGLPTTGGH 283 >gb|EWC47518.1| mitochondrial phosphate carrier protein 2 [Drechslerella stenobrocha 248] Length = 317 Score = 94.0 bits (232), Expect = 2e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 G IGF+GLWNGLPVRI MIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 273 GNIGFTGLWNGLPVRIVMIGTLTAFQWLIYDSFKVYLGLPTTGGH 317 >gb|ETN39374.1| hypothetical protein HMPREF1541_05597 [Cyphellophora europaea CBS 101466] Length = 320 Score = 93.6 bits (231), Expect = 3e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 G IGF+GLWNGLPVRI MIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 276 GNIGFTGLWNGLPVRIAMIGTLTAFQWLIYDSFKVYLGLPTTGGH 320 >ref|XP_007589533.1| putative mitochondrial phosphate carrier protein [Neofusicoccum parvum UCRNP2] gi|485915306|gb|EOD42994.1| putative mitochondrial phosphate carrier protein [Neofusicoccum parvum UCRNP2] Length = 264 Score = 93.6 bits (231), Expect = 3e-17 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 G IGF GLWNGLPVRI MIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 220 GNIGFKGLWNGLPVRIVMIGTLTAFQWLIYDSFKVYLGLPTTGGH 264 >ref|XP_003868828.1| Pic2 protein [Candida orthopsilosis Co 90-125] gi|380353168|emb|CCG25924.1| Pic2 protein [Candida orthopsilosis] Length = 341 Score = 93.6 bits (231), Expect = 3e-17 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -1 Query: 229 KIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 KIGF+GLWNGLPVRIFMIGTLT FQWLIYDSFKVY+GLPTTGGH Sbjct: 298 KIGFAGLWNGLPVRIFMIGTLTGFQWLIYDSFKVYVGLPTTGGH 341 >ref|XP_755540.1| mitochondrial phosphate transporter Pic2 [Aspergillus fumigatus Af293] gi|66853178|gb|EAL93502.1| mitochondrial phosphate transporter Pic2, putative [Aspergillus fumigatus Af293] Length = 299 Score = 93.2 bits (230), Expect = 3e-17 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 GKIGFSGLWNGLPVRI M+GTLT FQWLIYDSFKV+LGLPTTGGH Sbjct: 255 GKIGFSGLWNGLPVRIVMLGTLTGFQWLIYDSFKVFLGLPTTGGH 299 >gb|EHY58178.1| MC family mitochondrial carrier protein [Exophiala dermatitidis NIH/UT8656] Length = 319 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 G IGFSGLWNGLPVRI MIGTLTAFQWLIYDSFKV+LGLPTTGGH Sbjct: 275 GNIGFSGLWNGLPVRIVMIGTLTAFQWLIYDSFKVWLGLPTTGGH 319 >gb|EDP54718.1| mitochondrial phosphate transporter Pic2, putative [Aspergillus fumigatus A1163] Length = 299 Score = 93.2 bits (230), Expect = 3e-17 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 GKIGFSGLWNGLPVRI M+GTLT FQWLIYDSFKV+LGLPTTGGH Sbjct: 255 GKIGFSGLWNGLPVRIVMLGTLTGFQWLIYDSFKVFLGLPTTGGH 299 >ref|XP_001260668.1| mitochondrial phosphate carrier protein [Neosartorya fischeri NRRL 181] gi|119408822|gb|EAW18771.1| mitochondrial phosphate carrier protein [Neosartorya fischeri NRRL 181] Length = 305 Score = 93.2 bits (230), Expect = 3e-17 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -1 Query: 232 GKIGFSGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 98 GKIGFSGLWNGLPVRI M+GTLT FQWLIYDSFKV+LGLPTTGGH Sbjct: 261 GKIGFSGLWNGLPVRIVMLGTLTGFQWLIYDSFKVFLGLPTTGGH 305