BLASTX nr result
ID: Akebia25_contig00038165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00038165 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_172434.1| RAB GTPase 11C [Arabidopsis thaliana] gi|302451... 172 3e-41 ref|XP_006349310.1| PREDICTED: ras-related protein RABA2a-like [... 172 3e-41 ref|XP_006417553.1| hypothetical protein EUTSA_v10008742mg [Eutr... 172 3e-41 ref|XP_006389492.1| hypothetical protein POPTR_0022s00350g [Popu... 172 3e-41 ref|XP_006305601.1| hypothetical protein CARUB_v10010267mg [Caps... 172 3e-41 ref|XP_004230439.1| PREDICTED: ras-related protein RABA2a-like [... 172 3e-41 ref|XP_002892514.1| hypothetical protein ARALYDRAFT_888208 [Arab... 172 3e-41 gb|ABK94045.1| unknown [Populus trichocarpa] 172 3e-41 ref|XP_002264444.1| PREDICTED: ras-related protein RABA2a [Vitis... 172 3e-41 ref|XP_007041174.1| RAB GTPase 11C [Theobroma cacao] gi|50870510... 172 6e-41 ref|XP_004300007.1| PREDICTED: ras-related protein RABA2a-like [... 172 6e-41 ref|XP_007225803.1| hypothetical protein PRUPE_ppa011290mg [Prun... 172 6e-41 ref|XP_006470954.1| PREDICTED: ras-related protein RABA2a-like [... 171 8e-41 ref|NP_001240030.1| uncharacterized protein LOC100797258 [Glycin... 171 8e-41 ref|XP_002526431.1| protein with unknown function [Ricinus commu... 171 8e-41 ref|NP_001147252.1| ras-related protein Rab11C [Zea mays] gi|195... 170 2e-40 ref|NP_001235133.1| uncharacterized protein LOC100499980 [Glycin... 170 2e-40 ref|XP_004155229.1| PREDICTED: ras-related protein RABA2a-like [... 169 4e-40 ref|XP_004133721.1| PREDICTED: ras-related protein RABA2a-like [... 169 4e-40 ref|XP_003592898.1| Ras-related protein RABA2a [Medicago truncat... 169 4e-40 >ref|NP_172434.1| RAB GTPase 11C [Arabidopsis thaliana] gi|3024516|sp|O04486.1|RAA2A_ARATH RecName: Full=Ras-related protein RABA2a; Short=AtRABA2a; AltName: Full=Ras-related protein Rab11C; Short=AtRab11C; Flags: Precursor gi|2160157|gb|AAB60720.1| Strong similarity to A. thaliana ara-2 (gb|ATHARA2). ESTs gb|ATTS2483,gb|ATTS2484,gb|AA042159 come from this gene [Arabidopsis thaliana] gi|2231303|gb|AAB61994.1| ras-related small GTPase [Arabidopsis thaliana] gi|15010638|gb|AAK73978.1| At1g09630/F21M12_2 [Arabidopsis thaliana] gi|21553810|gb|AAM62903.1| putative RAS-related protein RAB11C [Arabidopsis thaliana] gi|22137284|gb|AAM91487.1| At1g09630/F21M12_2 [Arabidopsis thaliana] gi|332190350|gb|AEE28471.1| RAB GTPase 11C [Arabidopsis thaliana] Length = 217 Score = 172 bits (437), Expect = 3e-41 Identities = 85/87 (97%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHADSNIVIMLIGN Sbjct: 99 TFENVSRWLKELRDHADSNIVIMLIGN 125 >ref|XP_006349310.1| PREDICTED: ras-related protein RABA2a-like [Solanum tuberosum] Length = 214 Score = 172 bits (437), Expect = 3e-41 Identities = 85/87 (97%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHADSNIVIMLIGN Sbjct: 99 TFENVSRWLKELRDHADSNIVIMLIGN 125 >ref|XP_006417553.1| hypothetical protein EUTSA_v10008742mg [Eutrema salsugineum] gi|557095324|gb|ESQ35906.1| hypothetical protein EUTSA_v10008742mg [Eutrema salsugineum] Length = 218 Score = 172 bits (437), Expect = 3e-41 Identities = 85/87 (97%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHADSNIVIMLIGN Sbjct: 99 TFENVSRWLKELRDHADSNIVIMLIGN 125 >ref|XP_006389492.1| hypothetical protein POPTR_0022s00350g [Populus trichocarpa] gi|550312315|gb|ERP48406.1| hypothetical protein POPTR_0022s00350g [Populus trichocarpa] Length = 217 Score = 172 bits (437), Expect = 3e-41 Identities = 85/87 (97%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHADSNIVIMLIGN Sbjct: 99 TFENVSRWLKELRDHADSNIVIMLIGN 125 >ref|XP_006305601.1| hypothetical protein CARUB_v10010267mg [Capsella rubella] gi|482574312|gb|EOA38499.1| hypothetical protein CARUB_v10010267mg [Capsella rubella] Length = 217 Score = 172 bits (437), Expect = 3e-41 Identities = 85/87 (97%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHADSNIVIMLIGN Sbjct: 99 TFENVSRWLKELRDHADSNIVIMLIGN 125 >ref|XP_004230439.1| PREDICTED: ras-related protein RABA2a-like [Solanum lycopersicum] Length = 214 Score = 172 bits (437), Expect = 3e-41 Identities = 85/87 (97%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHADSNIVIMLIGN Sbjct: 99 TFENVSRWLKELRDHADSNIVIMLIGN 125 >ref|XP_002892514.1| hypothetical protein ARALYDRAFT_888208 [Arabidopsis lyrata subsp. lyrata] gi|297338356|gb|EFH68773.1| hypothetical protein ARALYDRAFT_888208 [Arabidopsis lyrata subsp. lyrata] Length = 217 Score = 172 bits (437), Expect = 3e-41 Identities = 85/87 (97%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHADSNIVIMLIGN Sbjct: 99 TFENVSRWLKELRDHADSNIVIMLIGN 125 >gb|ABK94045.1| unknown [Populus trichocarpa] Length = 215 Score = 172 bits (437), Expect = 3e-41 Identities = 85/87 (97%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHADSNIVIMLIGN Sbjct: 99 TFENVSRWLKELRDHADSNIVIMLIGN 125 >ref|XP_002264444.1| PREDICTED: ras-related protein RABA2a [Vitis vinifera] gi|297739506|emb|CBI29688.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 172 bits (437), Expect = 3e-41 Identities = 85/87 (97%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHADSNIVIMLIGN Sbjct: 99 TFENVSRWLKELRDHADSNIVIMLIGN 125 >ref|XP_007041174.1| RAB GTPase 11C [Theobroma cacao] gi|508705109|gb|EOX97005.1| RAB GTPase 11C [Theobroma cacao] Length = 215 Score = 172 bits (435), Expect = 6e-41 Identities = 84/87 (96%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHADSNIVIM+IGN Sbjct: 99 TFENVSRWLKELRDHADSNIVIMMIGN 125 >ref|XP_004300007.1| PREDICTED: ras-related protein RABA2a-like [Fragaria vesca subsp. vesca] Length = 216 Score = 172 bits (435), Expect = 6e-41 Identities = 84/87 (96%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHADSNIVIM+IGN Sbjct: 99 TFENVSRWLKELRDHADSNIVIMMIGN 125 >ref|XP_007225803.1| hypothetical protein PRUPE_ppa011290mg [Prunus persica] gi|462422739|gb|EMJ27002.1| hypothetical protein PRUPE_ppa011290mg [Prunus persica] Length = 216 Score = 172 bits (435), Expect = 6e-41 Identities = 84/87 (96%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHADSNIVIM+IGN Sbjct: 99 TFENVSRWLKELRDHADSNIVIMMIGN 125 >ref|XP_006470954.1| PREDICTED: ras-related protein RABA2a-like [Citrus sinensis] Length = 216 Score = 171 bits (434), Expect = 8e-41 Identities = 83/87 (95%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+T+KAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTIKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHADSNIVIM+IGN Sbjct: 99 TFENVSRWLKELRDHADSNIVIMMIGN 125 >ref|NP_001240030.1| uncharacterized protein LOC100797258 [Glycine max] gi|255645100|gb|ACU23049.1| unknown [Glycine max] Length = 217 Score = 171 bits (434), Expect = 8e-41 Identities = 84/87 (96%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHAD+NIVIMLIGN Sbjct: 99 TFENVSRWLKELRDHADANIVIMLIGN 125 >ref|XP_002526431.1| protein with unknown function [Ricinus communis] gi|223534211|gb|EEF35926.1| protein with unknown function [Ricinus communis] Length = 215 Score = 171 bits (434), Expect = 8e-41 Identities = 84/87 (96%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHAD+NIVIMLIGN Sbjct: 99 TFENVSRWLKELRDHADANIVIMLIGN 125 >ref|NP_001147252.1| ras-related protein Rab11C [Zea mays] gi|195609118|gb|ACG26389.1| ras-related protein Rab11C [Zea mays] Length = 217 Score = 170 bits (431), Expect = 2e-40 Identities = 84/87 (96%), Positives = 86/87 (98%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHAD NIVIMLIGN Sbjct: 99 TFENVSRWLKELRDHADYNIVIMLIGN 125 >ref|NP_001235133.1| uncharacterized protein LOC100499980 [Glycine max] gi|255628259|gb|ACU14474.1| unknown [Glycine max] Length = 216 Score = 170 bits (430), Expect = 2e-40 Identities = 84/87 (96%), Positives = 86/87 (98%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 39 LESKSTIGVEFATRTLQVEGGTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TFEN+SRWLKELRDHAD+NIVIMLIGN Sbjct: 99 TFENVSRWLKELRDHADANIVIMLIGN 125 >ref|XP_004155229.1| PREDICTED: ras-related protein RABA2a-like [Cucumis sativus] Length = 220 Score = 169 bits (428), Expect = 4e-40 Identities = 83/87 (95%), Positives = 86/87 (98%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKP Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPM 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TF+N+SRWLKELRDHADSNIVIMLIGN Sbjct: 99 TFDNVSRWLKELRDHADSNIVIMLIGN 125 >ref|XP_004133721.1| PREDICTED: ras-related protein RABA2a-like [Cucumis sativus] Length = 216 Score = 169 bits (428), Expect = 4e-40 Identities = 83/87 (95%), Positives = 86/87 (98%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKP Sbjct: 39 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPM 98 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TF+N+SRWLKELRDHADSNIVIMLIGN Sbjct: 99 TFDNVSRWLKELRDHADSNIVIMLIGN 125 >ref|XP_003592898.1| Ras-related protein RABA2a [Medicago truncatula] gi|92893896|gb|ABE91946.1| Ras GTPase; Sigma-54 factor, interaction region [Medicago truncatula] gi|355481946|gb|AES63149.1| Ras-related protein RABA2a [Medicago truncatula] Length = 220 Score = 169 bits (428), Expect = 4e-40 Identities = 82/87 (94%), Positives = 87/87 (100%) Frame = +3 Query: 3 LESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 182 LESKSTIGVEFATRTLQVEG+TVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT Sbjct: 42 LESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPT 101 Query: 183 TFENISRWLKELRDHADSNIVIMLIGN 263 TF+N++RWLKELRDHAD+NIVIMLIGN Sbjct: 102 TFDNVTRWLKELRDHADANIVIMLIGN 128