BLASTX nr result
ID: Akebia25_contig00037901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00037901 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM08819.1|AC090486_29 Putative retroelement [Oryza sativa Ja... 43 7e-08 gb|AAM19043.1|AC099774_5 putative reverse transcriptase [Oryza s... 43 7e-08 ref|XP_002457858.1| hypothetical protein SORBIDRAFT_03g016520 [S... 47 9e-08 emb|CAN70290.1| hypothetical protein VITISV_019345 [Vitis vinifera] 51 1e-07 emb|CAN72143.1| hypothetical protein VITISV_036307 [Vitis vinifera] 43 1e-07 ref|XP_002266640.2| PREDICTED: uncharacterized protein LOC100250... 43 3e-07 ref|XP_002461982.1| hypothetical protein SORBIDRAFT_02g011546 [S... 44 3e-07 emb|CAN72098.1| hypothetical protein VITISV_002674 [Vitis vinifera] 39 4e-07 ref|XP_007027495.1| Uncharacterized protein TCM_022315 [Theobrom... 36 4e-07 emb|CAN79131.1| hypothetical protein VITISV_034693 [Vitis vinifera] 47 4e-07 emb|CAN71912.1| hypothetical protein VITISV_018965 [Vitis vinifera] 43 5e-07 gb|ABB46597.2| retrotransposon, putative, centromere-specific [O... 40 5e-07 gb|AAM08499.1|AC068654_1 Putative retroelement [Oryza sativa Jap... 40 5e-07 emb|CAN69053.1| hypothetical protein VITISV_022963 [Vitis vinifera] 42 7e-07 emb|CAN82456.1| hypothetical protein VITISV_010028 [Vitis vinifera] 49 1e-06 emb|CAN60702.1| hypothetical protein VITISV_015869 [Vitis vinifera] 44 1e-06 ref|XP_002272748.2| PREDICTED: uncharacterized protein LOC100256... 49 1e-06 emb|CAN77850.1| hypothetical protein VITISV_020834 [Vitis vinifera] 49 1e-06 emb|CAN76026.1| hypothetical protein VITISV_027817 [Vitis vinifera] 49 1e-06 emb|CAN74183.1| hypothetical protein VITISV_034261 [Vitis vinifera] 43 1e-06 >gb|AAM08819.1|AC090486_29 Putative retroelement [Oryza sativa Japonica Group] gi|110288882|gb|ABB47173.2| retrotransposon protein, putative, unclassified [Oryza sativa Japonica Group] Length = 1265 Score = 42.7 bits (99), Expect(3) = 7e-08 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +1 Query: 1 PDFRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 P FR+ RGLRQGDPLSPLLF LV + L L +A Sbjct: 1057 PFFRTFRGLRQGDPLSPLLFNLVGDALAVILEKA 1090 Score = 29.6 bits (65), Expect(3) = 7e-08 Identities = 10/21 (47%), Positives = 19/21 (90%) Frame = +2 Query: 236 VLFCFEAVSRLRINFRKSKMF 298 +LFCFE +S ++IN++KS+++ Sbjct: 1134 LLFCFEEMSGMKINYQKSEVY 1154 Score = 28.9 bits (63), Expect(3) = 7e-08 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 153 VSFLHFADDTSVFLGAEDWQVKYLRGVLCCF 245 +S L +ADDT +F+ D V+ L+ +L CF Sbjct: 1108 LSHLQYADDTILFIKVGDDNVRVLKFLLFCF 1138 >gb|AAM19043.1|AC099774_5 putative reverse transcriptase [Oryza sativa Japonica Group] Length = 1259 Score = 42.7 bits (99), Expect(3) = 7e-08 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +1 Query: 1 PDFRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 P FR+ RGLRQGDPLSPLLF LV + L L +A Sbjct: 1051 PFFRTFRGLRQGDPLSPLLFNLVGDALAVILEKA 1084 Score = 29.6 bits (65), Expect(3) = 7e-08 Identities = 10/21 (47%), Positives = 19/21 (90%) Frame = +2 Query: 236 VLFCFEAVSRLRINFRKSKMF 298 +LFCFE +S ++IN++KS+++ Sbjct: 1128 LLFCFEEMSGMKINYQKSEVY 1148 Score = 28.9 bits (63), Expect(3) = 7e-08 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 153 VSFLHFADDTSVFLGAEDWQVKYLRGVLCCF 245 +S L +ADDT +F+ D V+ L+ +L CF Sbjct: 1102 LSHLQYADDTILFIKVGDDNVRVLKFLLFCF 1132 >ref|XP_002457858.1| hypothetical protein SORBIDRAFT_03g016520 [Sorghum bicolor] gi|241929833|gb|EES02978.1| hypothetical protein SORBIDRAFT_03g016520 [Sorghum bicolor] Length = 776 Score = 47.4 bits (111), Expect(3) = 9e-08 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +1 Query: 1 PDFRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 P F++ RGLRQGDPLSPLLF +V VLG FL +A Sbjct: 475 PYFKTFRGLRQGDPLSPLLFNMVANVLGVFLDKA 508 Score = 30.0 bits (66), Expect(3) = 9e-08 Identities = 9/23 (39%), Positives = 20/23 (86%) Frame = +2 Query: 233 IVLFCFEAVSRLRINFRKSKMFG 301 ++L+CFE ++ ++IN+ KS+++G Sbjct: 551 LILYCFEWLTGMKINYHKSEVYG 573 Score = 23.5 bits (49), Expect(3) = 9e-08 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +3 Query: 153 VSFLHFADDTSVFLGAEDWQVKYLRGVLCCF 245 ++ + +ADDT + + + L+ +L CF Sbjct: 526 ITHIQYADDTVIMIDGSVTSISNLKLILYCF 556 >emb|CAN70290.1| hypothetical protein VITISV_019345 [Vitis vinifera] Length = 1464 Score = 50.8 bits (120), Expect(3) = 1e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 FRS+RGLRQGDPLSP LF+LV+E+L Q L RA Sbjct: 347 FRSTRGLRQGDPLSPYLFLLVMEILSQLLFRA 378 Score = 25.8 bits (55), Expect(3) = 1e-07 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 162 LHFADDTSVFLGAEDWQVKYLRGVLCCF 245 L FADDT +F A Q++YL V F Sbjct: 402 LLFADDTPLFCKANSEQLRYLSWVFLWF 429 Score = 23.9 bits (50), Expect(3) = 1e-07 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 230 SIVLFCFEAVSRLRINFRKSK 292 S V FEA+SRL++N KS+ Sbjct: 423 SWVFLWFEAISRLKVNRDKSE 443 >emb|CAN72143.1| hypothetical protein VITISV_036307 [Vitis vinifera] Length = 781 Score = 43.1 bits (100), Expect(3) = 1e-07 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 F SS+GLRQGDP+SP LF + +EVL F+ RA Sbjct: 264 FSSSKGLRQGDPISPYLFFMGMEVLSAFIRRA 295 Score = 31.2 bits (69), Expect(3) = 1e-07 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 144 MILVSFLHFADDTSVFLGAEDWQVKYLRGVLCCF 245 ++ +S L FADDT VF A+ + YL +LC F Sbjct: 313 VVNISHLLFADDTIVFCEAKKEDMTYLSWILCWF 346 Score = 26.2 bits (56), Expect(3) = 1e-07 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +2 Query: 230 SIVLFCFEAVSRLRINFRKSKMFGV 304 S +L FEAVS LRIN KS++ V Sbjct: 340 SWILCWFEAVSGLRINLAKSEIIPV 364 >ref|XP_002266640.2| PREDICTED: uncharacterized protein LOC100250082 [Vitis vinifera] Length = 1015 Score = 42.7 bits (99), Expect(3) = 3e-07 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 F SS+GLRQGDP+SP LFV+ +EVL + RA Sbjct: 187 FSSSKGLRQGDPISPYLFVMGMEVLSALIRRA 218 Score = 28.5 bits (62), Expect(3) = 3e-07 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 141 RMILVSFLHFADDTSVFLGAEDWQVKYLRGVLCCF 245 ++I ++ L FADD VF A + YL +LC F Sbjct: 235 QVINITHLLFADDAIVFCEASKEDMTYLSWILCWF 269 Score = 28.1 bits (61), Expect(3) = 3e-07 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = +2 Query: 230 SIVLFCFEAVSRLRINFRKSKM 295 S +L FEAVSRLRIN KS++ Sbjct: 263 SWILCWFEAVSRLRINLAKSEI 284 >ref|XP_002461982.1| hypothetical protein SORBIDRAFT_02g011546 [Sorghum bicolor] gi|241925359|gb|EER98503.1| hypothetical protein SORBIDRAFT_02g011546 [Sorghum bicolor] Length = 761 Score = 43.9 bits (102), Expect(3) = 3e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL 93 FR+ RGLRQGDPLSPLLF LV + LG L Sbjct: 603 FRTFRGLRQGDPLSPLLFNLVADALGVML 631 Score = 30.8 bits (68), Expect(3) = 3e-07 Identities = 11/22 (50%), Positives = 19/22 (86%) Frame = +2 Query: 233 IVLFCFEAVSRLRINFRKSKMF 298 ++L+CFE +S L+IN+ KS++F Sbjct: 677 LILYCFEWLSGLKINYHKSEIF 698 Score = 24.6 bits (52), Expect(3) = 3e-07 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +3 Query: 153 VSFLHFADDTSVFLGAEDWQVKYLRGVLCCF 245 +S + +ADDT + + ++ L+ +L CF Sbjct: 652 ISHIQYADDTVIMVDTTVQSIRNLKLILYCF 682 >emb|CAN72098.1| hypothetical protein VITISV_002674 [Vitis vinifera] Length = 1444 Score = 39.3 bits (90), Expect(3) = 4e-07 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +1 Query: 16 SRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 S+GLRQGDP+SP LFV+ +EVL + RA Sbjct: 320 SKGLRQGDPISPYLFVMGMEVLSALIRRA 348 Score = 30.4 bits (67), Expect(3) = 4e-07 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 141 RMILVSFLHFADDTSVFLGAEDWQVKYLRGVLCCF 245 +++ +S L FADDT VF A + YL +LC F Sbjct: 365 QVVNISQLLFADDTIVFCEARKEDMTYLSWILCWF 399 Score = 28.9 bits (63), Expect(3) = 4e-07 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 230 SIVLFCFEAVSRLRINFRKSKMFGV 304 S +L FEAVSRLRIN KS++ V Sbjct: 393 SWILCWFEAVSRLRINLAKSEIIPV 417 >ref|XP_007027495.1| Uncharacterized protein TCM_022315 [Theobroma cacao] gi|508716100|gb|EOY07997.1| Uncharacterized protein TCM_022315 [Theobroma cacao] Length = 667 Score = 36.2 bits (82), Expect(3) = 4e-07 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL 93 F+ SRGLRQG PLSP LF +V + Q + Sbjct: 79 FKMSRGLRQGCPLSPFLFNIVAKAFSQMM 107 Score = 32.7 bits (73), Expect(3) = 4e-07 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +2 Query: 236 VLFCFEAVSRLRINFRKSKMFGV 304 +L CF+A+S LRINF KS + G+ Sbjct: 154 ILRCFQAISGLRINFHKSSLAGI 176 Score = 29.6 bits (65), Expect(3) = 4e-07 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +3 Query: 138 VRMILVSFLHFADDTSVFLGAEDWQVKYLRGVLCCF 245 +R + +S L FADDT +FL +E + + +L CF Sbjct: 123 LRGLRISHLQFADDTMIFLKSEIESLVNAKRILRCF 158 >emb|CAN79131.1| hypothetical protein VITISV_034693 [Vitis vinifera] Length = 558 Score = 46.6 bits (109), Expect(3) = 4e-07 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 F SSRGLRQGDPLSP LF++ +EVL F+ RA Sbjct: 386 FSSSRGLRQGDPLSPYLFIMGMEVLSAFIRRA 417 Score = 26.9 bits (58), Expect(3) = 4e-07 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 153 VSFLHFADDTSVFLGAEDWQVKYLRGVLCCF 245 +S L FADD VF A+ + +L +LC F Sbjct: 438 ISHLLFADDAIVFCEAKKDDMTFLSWILCWF 468 Score = 25.0 bits (53), Expect(3) = 4e-07 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 230 SIVLFCFEAVSRLRINFRKSKMFGV 304 S +L FEA S LRIN KS++ V Sbjct: 462 SWILCWFEAASXLRINLAKSEIIPV 486 >emb|CAN71912.1| hypothetical protein VITISV_018965 [Vitis vinifera] Length = 1856 Score = 43.1 bits (100), Expect(3) = 5e-07 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 F SS+GLRQGDPLSP LF++ +EVL + RA Sbjct: 752 FSSSKGLRQGDPLSPYLFIMGMEVLSALIRRA 783 Score = 27.7 bits (60), Expect(3) = 5e-07 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 147 ILVSFLHFADDTSVFLGAEDWQVKYLRGVLCCF 245 +++S + FADD VF A + +L +LC F Sbjct: 802 VIISHILFADDAIVFCEARKDDMTFLSWILCWF 834 Score = 27.3 bits (59), Expect(3) = 5e-07 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +2 Query: 230 SIVLFCFEAVSRLRINFRKSKMFGV 304 S +L FEA SRLRIN KS++ V Sbjct: 828 SWILCWFEAASRLRINLAKSEIIPV 852 >gb|ABB46597.2| retrotransposon, putative, centromere-specific [Oryza sativa Japonica Group] Length = 1048 Score = 40.0 bits (92), Expect(3) = 5e-07 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 FR+ +G+RQGDPLSPLLF V L + L RA Sbjct: 675 FRTYKGVRQGDPLSPLLFNYVANALSEMLTRA 706 Score = 30.8 bits (68), Expect(3) = 5e-07 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +2 Query: 236 VLFCFEAVSRLRINFRKSKM 295 +LFCFE +S L+IN++KS+M Sbjct: 750 LLFCFEEMSGLKINYQKSEM 769 Score = 27.3 bits (59), Expect(3) = 5e-07 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +3 Query: 153 VSFLHFADDTSVFLGAEDWQVKYLRGVLCCF 245 +++L +ADDT++F+ D + + +L CF Sbjct: 724 LTYLQYADDTTLFMSLSDENICTAKFLLFCF 754 >gb|AAM08499.1|AC068654_1 Putative retroelement [Oryza sativa Japonica Group] Length = 988 Score = 40.0 bits (92), Expect(3) = 5e-07 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 FR+ +G+RQGDPLSPLLF V L + L RA Sbjct: 675 FRTYKGVRQGDPLSPLLFNYVANALSEMLTRA 706 Score = 30.8 bits (68), Expect(3) = 5e-07 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +2 Query: 236 VLFCFEAVSRLRINFRKSKM 295 +LFCFE +S L+IN++KS+M Sbjct: 750 LLFCFEEMSGLKINYQKSEM 769 Score = 27.3 bits (59), Expect(3) = 5e-07 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +3 Query: 153 VSFLHFADDTSVFLGAEDWQVKYLRGVLCCF 245 +++L +ADDT++F+ D + + +L CF Sbjct: 724 LTYLQYADDTTLFMSLSDENICTAKFLLFCF 754 >emb|CAN69053.1| hypothetical protein VITISV_022963 [Vitis vinifera] Length = 2021 Score = 42.0 bits (97), Expect(3) = 7e-07 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 F + RGLRQGDPLSP LFVL++E L + RA Sbjct: 1437 FSTFRGLRQGDPLSPYLFVLIMEGLSSLISRA 1468 Score = 28.1 bits (61), Expect(3) = 7e-07 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 147 ILVSFLHFADDTSVFLGAEDWQVKYLRGVLCCF 245 +LVS L FADDT +F + Q+ + + V+ CF Sbjct: 1487 VLVSHLLFADDTLLFCEDDRDQLIFWKWVVICF 1519 Score = 27.7 bits (60), Expect(3) = 7e-07 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +2 Query: 236 VLFCFEAVSRLRINFRKSKMFGV 304 V+ CFE VS L+IN +KS++ + Sbjct: 1515 VVICFEVVSGLKINLQKSEIIPI 1537 >emb|CAN82456.1| hypothetical protein VITISV_010028 [Vitis vinifera] Length = 4128 Score = 49.3 bits (116), Expect(2) = 1e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 FRSSRGLRQGDPLSP LF+L +E L Q L RA Sbjct: 3035 FRSSRGLRQGDPLSPYLFLLAMEALSQLLSRA 3066 Score = 28.5 bits (62), Expect(2) = 1e-06 Identities = 18/46 (39%), Positives = 25/46 (54%) Frame = +3 Query: 147 ILVSFLHFADDTSVFLGAEDWQVKYLRGVLCCFVLRRCQD*ESISG 284 ++VS L FADDT +F A+ Q++YL F E+ISG Sbjct: 3085 LVVSHLLFADDTLIFCDADADQLQYLSWTFMWF--------EAISG 3122 >emb|CAN60702.1| hypothetical protein VITISV_015869 [Vitis vinifera] Length = 3028 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 F SSRGLRQGDPLSP LFV+ +E L + + RA Sbjct: 2491 FNSSRGLRQGDPLSPYLFVIGMEALSRLINRA 2522 Score = 33.5 bits (75), Expect(2) = 1e-06 Identities = 26/61 (42%), Positives = 32/61 (52%), Gaps = 7/61 (11%) Frame = +3 Query: 123 GFLSKVRM-------ILVSFLHFADDTSVFLGAEDWQVKYLRGVLCCFVLRRCQD*ESIS 281 GFLS R+ +LVS L FADDT VF A + Q+ YL +L F E+IS Sbjct: 2526 GFLSGCRVDGRGGNGVLVSHLLFADDTLVFCEASEDQMVYLSWLLMWF--------EAIS 2577 Query: 282 G 284 G Sbjct: 2578 G 2578 >ref|XP_002272748.2| PREDICTED: uncharacterized protein LOC100256388 [Vitis vinifera] Length = 2667 Score = 49.3 bits (116), Expect(2) = 1e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 FRSSRGLRQGDPLSP LF+L +E L Q L RA Sbjct: 634 FRSSRGLRQGDPLSPYLFLLAMEALSQLLSRA 665 Score = 28.5 bits (62), Expect(2) = 1e-06 Identities = 18/46 (39%), Positives = 25/46 (54%) Frame = +3 Query: 147 ILVSFLHFADDTSVFLGAEDWQVKYLRGVLCCFVLRRCQD*ESISG 284 ++VS L FADDT +F A+ Q++YL F E+ISG Sbjct: 684 LVVSHLLFADDTLIFCDADADQLQYLSWTFMWF--------EAISG 721 >emb|CAN77850.1| hypothetical protein VITISV_020834 [Vitis vinifera] Length = 1905 Score = 49.3 bits (116), Expect(2) = 1e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 FRSSRGLRQGDPLSP LF+L +E L Q L RA Sbjct: 1323 FRSSRGLRQGDPLSPYLFLLAMEALSQLLSRA 1354 Score = 28.5 bits (62), Expect(2) = 1e-06 Identities = 18/46 (39%), Positives = 25/46 (54%) Frame = +3 Query: 147 ILVSFLHFADDTSVFLGAEDWQVKYLRGVLCCFVLRRCQD*ESISG 284 ++VS L FADDT +F A+ Q++YL F E+ISG Sbjct: 1373 LVVSHLLFADDTLIFCDADADQLQYLSWTFMWF--------EAISG 1410 >emb|CAN76026.1| hypothetical protein VITISV_027817 [Vitis vinifera] Length = 1728 Score = 49.3 bits (116), Expect(2) = 1e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 FRSSRGLRQGDPLSP LF+L +E L Q L RA Sbjct: 715 FRSSRGLRQGDPLSPYLFLLAMEALSQLLSRA 746 Score = 28.5 bits (62), Expect(2) = 1e-06 Identities = 18/46 (39%), Positives = 25/46 (54%) Frame = +3 Query: 147 ILVSFLHFADDTSVFLGAEDWQVKYLRGVLCCFVLRRCQD*ESISG 284 ++VS L FADDT +F A+ Q++YL F E+ISG Sbjct: 765 LVVSHLLFADDTLIFCDADADQLQYLSWTFMWF--------EAISG 802 >emb|CAN74183.1| hypothetical protein VITISV_034261 [Vitis vinifera] Length = 1201 Score = 43.1 bits (100), Expect(3) = 1e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +1 Query: 7 FRSSRGLRQGDPLSPLLFVLVVEVLGQFL*RA 102 F + RGLRQGDPLSP LFVL++E L + RA Sbjct: 615 FSTFRGLRQGDPLSPYLFVLIMEALSSLISRA 646 Score = 27.7 bits (60), Expect(3) = 1e-06 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +2 Query: 236 VLFCFEAVSRLRINFRKSKMFGV 304 V+ CFE VS L+IN +KS++ + Sbjct: 693 VVICFEVVSGLKINLQKSEIIPI 715 Score = 25.8 bits (55), Expect(3) = 1e-06 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 147 ILVSFLHFADDTSVFLGAEDWQVKYLRGVLCCF 245 + VS L FADDT +F + Q+ + + V+ CF Sbjct: 665 VSVSHLLFADDTLLFCEDDRDQLIFWKWVVICF 697