BLASTX nr result
ID: Akebia25_contig00037825
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00037825 (207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529228.1| conserved hypothetical protein [Ricinus comm... 59 7e-07 ref|XP_002310032.1| programmed cell death 2 C-terminal domain-co... 57 3e-06 >ref|XP_002529228.1| conserved hypothetical protein [Ricinus communis] gi|223531301|gb|EEF33141.1| conserved hypothetical protein [Ricinus communis] Length = 380 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -1 Query: 207 CSKSCSLPSHQEKSGSKGWTVAEEAVMVQFEKPLHGSAELGY 82 CSKSCS PS+Q K+ + GW V EEAV+VQ E PLH S LGY Sbjct: 337 CSKSCSNPSNQAKNETGGWIVVEEAVVVQLETPLHESVHLGY 378 >ref|XP_002310032.1| programmed cell death 2 C-terminal domain-containing family protein [Populus trichocarpa] gi|222852935|gb|EEE90482.1| programmed cell death 2 C-terminal domain-containing family protein [Populus trichocarpa] Length = 377 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -1 Query: 207 CSKSCSLPSHQEKSGSKGWTVAEEAVMVQFEKPLHGSAELGY 82 CSKSCS +EKS + GWTVAEEAV+VQFEK LH S GY Sbjct: 334 CSKSCSNSFDREKSTTSGWTVAEEAVLVQFEKALHESILPGY 375