BLASTX nr result
ID: Akebia25_contig00037721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00037721 (270 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME80501.1| hypothetical protein MYCFIDRAFT_54532 [Pseudocerc... 48 1e-12 ref|XP_003851050.1| hypothetical protein MYCGRDRAFT_44923 [Zymos... 42 2e-07 >gb|EME80501.1| hypothetical protein MYCFIDRAFT_54532 [Pseudocercospora fijiensis CIRAD86] Length = 181 Score = 48.1 bits (113), Expect(3) = 1e-12 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -3 Query: 133 ELHSMTIIPRPQMMLAC*R*VDRPNDRLNTADKSDGKRFPFNNF 2 ELHS +I R Q M+A R V+R DR NTA KS RFPFNNF Sbjct: 43 ELHSSGLIQRSQTMMASRRRVNRSEDRPNTAAKSGCGRFPFNNF 86 Score = 37.4 bits (85), Expect(3) = 1e-12 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = -2 Query: 254 VIDSLIRVSRRAVCNHYASILAMRGPHPG 168 ++DSL+RVSRRA NHYA ILA PG Sbjct: 1 MLDSLVRVSRRAADNHYAIILAEARTSPG 29 Score = 32.7 bits (73), Expect(3) = 1e-12 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 192 SNARTSPGARGISPGYNTPR 133 + ARTSPG R I+ GYNTPR Sbjct: 22 AEARTSPGTRCITRGYNTPR 41 >ref|XP_003851050.1| hypothetical protein MYCGRDRAFT_44923 [Zymoseptoria tritici IPO323] gi|398395195|ref|XP_003851056.1| hypothetical protein MYCGRDRAFT_44515 [Zymoseptoria tritici IPO323] gi|339470929|gb|EGP86026.1| hypothetical protein MYCGRDRAFT_44923 [Zymoseptoria tritici IPO323] gi|339470935|gb|EGP86032.1| hypothetical protein MYCGRDRAFT_44515 [Zymoseptoria tritici IPO323] Length = 55 Score = 42.4 bits (98), Expect(2) = 2e-07 Identities = 22/34 (64%), Positives = 25/34 (73%), Gaps = 2/34 (5%) Frame = -1 Query: 192 SNARTSPGARGISPGYNTP--RSYIP*LLSHGPR 97 + ARTSPG R I+ GYNTP SYIP +LS GPR Sbjct: 22 AEARTSPGTRRITTGYNTPPRGSYIPEVLSGGPR 55 Score = 38.5 bits (88), Expect(2) = 2e-07 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -2 Query: 254 VIDSLIRVSRRAVCNHYASILAMRGPHPG 168 ++DSL+RVSRRA NHYA+ILA PG Sbjct: 1 MLDSLVRVSRRAADNHYANILAEARTSPG 29