BLASTX nr result
ID: Akebia25_contig00037611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00037611 (214 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_662849.1| hypothetical protein AN5245.2 [Aspergillus nidu... 56 6e-06 >ref|XP_662849.1| hypothetical protein AN5245.2 [Aspergillus nidulans FGSC A4] gi|40742997|gb|EAA62187.1| predicted protein [Aspergillus nidulans FGSC A4] gi|259484709|tpe|CBF81163.1| TPA: hypothetical protein ANIA_05245 [Aspergillus nidulans FGSC A4] Length = 198 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/52 (59%), Positives = 34/52 (65%) Frame = +1 Query: 37 QQGYSTAYTTRSDN*VVCKGFIPARCEIAIRRLVTRHFHRGTVADLLGSGAR 192 QQGY TAYTTR VVC+GFIPAR +IAIR+ F G VA LL AR Sbjct: 91 QQGYLTAYTTRLVTSVVCRGFIPARGDIAIRQPAPEGFSPGAVASLLRYRAR 142