BLASTX nr result
ID: Akebia25_contig00037242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00037242 (230 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006494604.1| PREDICTED: transcription initiation factor T... 59 9e-07 ref|XP_006420853.1| hypothetical protein CICLE_v100041253mg, par... 59 9e-07 ref|XP_006420851.1| hypothetical protein CICLE_v10004140mg [Citr... 57 3e-06 ref|XP_006420850.1| hypothetical protein CICLE_v10004140mg [Citr... 57 3e-06 ref|XP_007033798.1| Histone acetyltransferase, putative [Theobro... 56 5e-06 ref|XP_007225488.1| hypothetical protein PRUPE_ppa000092mg [Prun... 56 6e-06 ref|XP_002522626.1| transcription initiation factor tfiid, putat... 55 8e-06 >ref|XP_006494604.1| PREDICTED: transcription initiation factor TFIID subunit 1-like [Citrus sinensis] Length = 1944 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 92 ATSLPILCMEDGKVVLRFSEIFGIHEPLKK 3 +T LP+LC+EDGKV+LRFSEIFGIHEPLKK Sbjct: 230 STPLPVLCVEDGKVILRFSEIFGIHEPLKK 259 >ref|XP_006420853.1| hypothetical protein CICLE_v100041253mg, partial [Citrus clementina] gi|557522726|gb|ESR34093.1| hypothetical protein CICLE_v100041253mg, partial [Citrus clementina] Length = 1051 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 92 ATSLPILCMEDGKVVLRFSEIFGIHEPLKK 3 +T LP+LC+EDGKV+LRFSEIFGIHEPLKK Sbjct: 141 STPLPVLCVEDGKVILRFSEIFGIHEPLKK 170 >ref|XP_006420851.1| hypothetical protein CICLE_v10004140mg [Citrus clementina] gi|557522724|gb|ESR34091.1| hypothetical protein CICLE_v10004140mg [Citrus clementina] Length = 1339 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -1 Query: 92 ATSLPILCMEDGKVVLRFSEIFGIHEPLKK 3 +T LP+LC+E+GKV+LRFSEIFGIHEPLKK Sbjct: 242 STPLPVLCVEEGKVILRFSEIFGIHEPLKK 271 >ref|XP_006420850.1| hypothetical protein CICLE_v10004140mg [Citrus clementina] gi|557522723|gb|ESR34090.1| hypothetical protein CICLE_v10004140mg [Citrus clementina] Length = 1594 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -1 Query: 92 ATSLPILCMEDGKVVLRFSEIFGIHEPLKK 3 +T LP+LC+E+GKV+LRFSEIFGIHEPLKK Sbjct: 242 STPLPVLCVEEGKVILRFSEIFGIHEPLKK 271 >ref|XP_007033798.1| Histone acetyltransferase, putative [Theobroma cacao] gi|508712827|gb|EOY04724.1| Histone acetyltransferase, putative [Theobroma cacao] Length = 1899 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 92 ATSLPILCMEDGKVVLRFSEIFGIHEPLKK 3 +T LP+LC+EDG V+LRFSEIFGIHEPLKK Sbjct: 209 STPLPVLCVEDGMVILRFSEIFGIHEPLKK 238 >ref|XP_007225488.1| hypothetical protein PRUPE_ppa000092mg [Prunus persica] gi|462422424|gb|EMJ26687.1| hypothetical protein PRUPE_ppa000092mg [Prunus persica] Length = 1849 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 95 SATSLPILCMEDGKVVLRFSEIFGIHEPLKK 3 SAT LP+LC+EDG V+LRFSEIFGIH PLKK Sbjct: 153 SATPLPVLCIEDGLVILRFSEIFGIHVPLKK 183 >ref|XP_002522626.1| transcription initiation factor tfiid, putative [Ricinus communis] gi|223538102|gb|EEF39713.1| transcription initiation factor tfiid, putative [Ricinus communis] Length = 1885 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 95 SATSLPILCMEDGKVVLRFSEIFGIHEPLKK 3 S+ LP+LC+EDG V+LRFSEIFGIHEPLKK Sbjct: 211 SSAPLPVLCVEDGLVILRFSEIFGIHEPLKK 241