BLASTX nr result
ID: Akebia25_contig00037206
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00037206 (439 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME46174.1| hypothetical protein DOTSEDRAFT_51725 [Dothistrom... 84 2e-14 gb|EME82773.1| hypothetical protein MYCFIDRAFT_182627 [Pseudocer... 79 9e-13 gb|EON68467.1| hypothetical protein W97_07677 [Coniosporium apol... 78 1e-12 gb|EMF14274.1| hypothetical protein SEPMUDRAFT_148040 [Sphaeruli... 76 4e-12 ref|XP_001790768.1| hypothetical protein SNOG_00071 [Phaeosphaer... 76 4e-12 ref|XP_007584035.1| hypothetical protein UCRNP2_4754 [Neofusicoc... 74 2e-11 gb|EMC99518.1| hypothetical protein BAUCODRAFT_339516 [Baudoinia... 74 2e-11 gb|EKG12993.1| hypothetical protein MPH_09874 [Macrophomina phas... 74 2e-11 ref|XP_003303822.1| hypothetical protein PTT_16189 [Pyrenophora ... 72 6e-11 ref|XP_001940593.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_003834786.1| hypothetical protein LEMA_P069290.1 [Leptosp... 72 1e-10 gb|EOA86686.1| hypothetical protein SETTUDRAFT_162885 [Setosphae... 71 2e-10 gb|EUC35375.1| hypothetical protein COCCADRAFT_24662 [Bipolaris ... 65 8e-09 gb|EMD95722.1| hypothetical protein COCHEDRAFT_1019352 [Bipolari... 65 8e-09 gb|EMD69402.1| hypothetical protein COCSADRAFT_166388 [Bipolaris... 65 1e-08 ref|XP_003857720.1| hypothetical protein MYCGRDRAFT_32028 [Zymos... 61 2e-07 ref|XP_003071778.1| hypothetical protein CPC735_073150 [Coccidio... 56 5e-06 ref|XP_001244998.1| hypothetical protein CIMG_04439 [Coccidioide... 56 5e-06 gb|ELR02306.1| hypothetical protein GMDG_05375 [Pseudogymnoascus... 56 6e-06 ref|XP_002542150.1| conserved hypothetical protein [Uncinocarpus... 55 8e-06 >gb|EME46174.1| hypothetical protein DOTSEDRAFT_51725 [Dothistroma septosporum NZE10] Length = 198 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/58 (67%), Positives = 50/58 (86%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSIT 438 MPIPSYGAAPL+ TF+ VRGL ++CMI ILGMT NFV+++V ++ EP RE+VGTL+IT Sbjct: 1 MPIPSYGAAPLAKTFVLVRGLSLICMIAILGMTANFVSEIVASNVEPPREVVGTLTIT 58 >gb|EME82773.1| hypothetical protein MYCFIDRAFT_182627 [Pseudocercospora fijiensis CIRAD86] Length = 198 Score = 78.6 bits (192), Expect = 9e-13 Identities = 39/58 (67%), Positives = 46/58 (79%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSIT 438 MPIP YGAAPL+ TF+ VRGL +V MI I+GMT NFV+Q+V EP REIVGTL+IT Sbjct: 1 MPIPDYGAAPLAKTFVLVRGLSLVSMIAIVGMTANFVSQIVSTKVEPPREIVGTLTIT 58 >gb|EON68467.1| hypothetical protein W97_07677 [Coniosporium apollinis CBS 100218] Length = 198 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/58 (62%), Positives = 47/58 (81%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSIT 438 MPIPSYGAAPLS TF+ VR +QV+ MI I+GMT NFV++++ + EP +EIVGTL +T Sbjct: 1 MPIPSYGAAPLSKTFVLVRAMQVISMIAIVGMTANFVSEIIQSGVEPPKEIVGTLCVT 58 >gb|EMF14274.1| hypothetical protein SEPMUDRAFT_148040 [Sphaerulina musiva SO2202] Length = 203 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/58 (58%), Positives = 46/58 (79%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSIT 438 MP+P YGAAPL+ TF+ VRGL ++CMI I+GMT NFV +++ + EP +EIVGTL +T Sbjct: 1 MPVPEYGAAPLAKTFVLVRGLSLICMIAIVGMTANFVAEIIGSSVEPPKEIVGTLVVT 58 >ref|XP_001790768.1| hypothetical protein SNOG_00071 [Phaeosphaeria nodorum SN15] gi|111070446|gb|EAT91566.1| hypothetical protein SNOG_00071 [Phaeosphaeria nodorum SN15] Length = 198 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/58 (58%), Positives = 43/58 (74%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSIT 438 MP+PSYGA PLS FL VR LQ +CMI+++G+T NFV +V EP +E VGTLS+T Sbjct: 1 MPVPSYGAMPLSKMFLAVRVLQAICMIIVIGITSNFVQMIVTTGVEPPKEFVGTLSVT 58 >ref|XP_007584035.1| hypothetical protein UCRNP2_4754 [Neofusicoccum parvum UCRNP2] gi|485923228|gb|EOD48427.1| hypothetical protein UCRNP2_4754 [Neofusicoccum parvum UCRNP2] Length = 199 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/58 (56%), Positives = 46/58 (79%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSIT 438 MP+P+YGAAPLS TF VR L+V+ MI+++G+ NFVN +V + EP +E+VGTLS+T Sbjct: 1 MPVPAYGAAPLSKTFALVRVLEVISMIIVVGIAANFVNDIVSSGIEPPKEVVGTLSVT 58 >gb|EMC99518.1| hypothetical protein BAUCODRAFT_339516 [Baudoinia compniacensis UAMH 10762] Length = 199 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/58 (60%), Positives = 46/58 (79%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSIT 438 MPIP YGAAPL+ TFL RGL +V MI I+G+T NFV+++V ++ +P REIVGTL+ T Sbjct: 1 MPIPDYGAAPLAKTFLLARGLSLVAMICIVGLTANFVSEIVSSNVDPPREIVGTLTTT 58 >gb|EKG12993.1| hypothetical protein MPH_09874 [Macrophomina phaseolina MS6] Length = 199 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/58 (56%), Positives = 46/58 (79%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSIT 438 MP+P+YGAAPLS TF VR L+V+ MI+++G+ NFVN +V + EP +E+VGTLS+T Sbjct: 1 MPVPAYGAAPLSKTFALVRVLEVISMIIVVGIAANFVNDIVSSGIEPPKEVVGTLSVT 58 >ref|XP_003303822.1| hypothetical protein PTT_16189 [Pyrenophora teres f. teres 0-1] gi|311319915|gb|EFQ88071.1| hypothetical protein PTT_16189 [Pyrenophora teres f. teres 0-1] Length = 197 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/58 (56%), Positives = 42/58 (72%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSIT 438 MP+PSY A PLS F+ VRGLQ +CMI+I+G+ NFV +V EP +E VGTLS+T Sbjct: 1 MPVPSYNAMPLSKMFVVVRGLQAICMILIIGICSNFVQMIVTTGVEPPKEFVGTLSVT 58 >ref|XP_001940593.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976686|gb|EDU43312.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 197 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSIT 438 MP+PSY A PLS F+ VRGLQ +CMI+++G+ NFV +V EP +E VGTLS+T Sbjct: 1 MPVPSYNAMPLSKMFVVVRGLQAICMILVIGICSNFVQMIVTTGVEPPKEFVGTLSVT 58 >ref|XP_003834786.1| hypothetical protein LEMA_P069290.1 [Leptosphaeria maculans JN3] gi|312211336|emb|CBX91421.1| hypothetical protein LEMA_P069290.1 [Leptosphaeria maculans JN3] Length = 198 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/57 (56%), Positives = 41/57 (71%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSI 435 MP+PSY A PLS FLGVR LQ +CMI+++G+ NFV +V EP +E VGTLS+ Sbjct: 1 MPVPSYNAMPLSKMFLGVRILQAICMIIVIGICSNFVQMIVTTGIEPPKEFVGTLSV 57 >gb|EOA86686.1| hypothetical protein SETTUDRAFT_162885 [Setosphaeria turcica Et28A] Length = 197 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/57 (54%), Positives = 41/57 (71%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSI 435 MP+P+Y A PLS +G RGLQV+CMI+I+G+ NFV +V EP +E VGTLS+ Sbjct: 1 MPVPTYNAKPLSMMLVGARGLQVICMIIIIGICSNFVQMIVTTGVEPPQEFVGTLSV 57 >gb|EUC35375.1| hypothetical protein COCCADRAFT_24662 [Bipolaris zeicola 26-R-13] gi|576937161|gb|EUC50651.1| hypothetical protein COCMIDRAFT_81531 [Bipolaris oryzae ATCC 44560] gi|578484211|gb|EUN21744.1| hypothetical protein COCVIDRAFT_42359 [Bipolaris victoriae FI3] Length = 197 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSI 435 MP+P+Y A PLS LG R LQ +CMI+++G+ NFV +V EP +E VGTLS+ Sbjct: 1 MPVPTYNAKPLSLMLLGTRVLQSICMILVIGICSNFVQMIVTTGVEPPKEFVGTLSV 57 >gb|EMD95722.1| hypothetical protein COCHEDRAFT_1019352 [Bipolaris maydis C5] gi|477593513|gb|ENI10582.1| hypothetical protein COCC4DRAFT_55238 [Bipolaris maydis ATCC 48331] Length = 197 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSI 435 MP+P+Y A PLS LG R LQ +CMI+++G+ NFV +V EP +E VGTLS+ Sbjct: 1 MPVPTYNAKPLSLMLLGTRVLQSICMILVIGICSNFVQMIVTTGVEPPKEFVGTLSV 57 >gb|EMD69402.1| hypothetical protein COCSADRAFT_166388 [Bipolaris sorokiniana ND90Pr] Length = 197 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSI 435 MP+P+Y A PLS LG R LQ +CM++++G+ NFV +V EP +E VGTLS+ Sbjct: 1 MPVPTYNAKPLSLMLLGTRVLQSICMVLVIGICSNFVQMIVTTGVEPPKEFVGTLSV 57 >ref|XP_003857720.1| hypothetical protein MYCGRDRAFT_32028 [Zymoseptoria tritici IPO323] gi|339477605|gb|EGP92696.1| hypothetical protein MYCGRDRAFT_32028 [Zymoseptoria tritici IPO323] Length = 191 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/58 (48%), Positives = 42/58 (72%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSIT 438 M IP Y A PL+ TF+ +R L ++ ++ I+G+T NFV+Q+V ++ P REIV TL+IT Sbjct: 1 MTIPEYNAPPLARTFVLIRTLSILVLLAIVGITANFVSQIVASNISPPREIVATLTIT 58 >ref|XP_003071778.1| hypothetical protein CPC735_073150 [Coccidioides posadasii C735 delta SOWgp] gi|240111480|gb|EER29633.1| hypothetical protein CPC735_073150 [Coccidioides posadasii C735 delta SOWgp] gi|320035067|gb|EFW17009.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] Length = 192 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = +1 Query: 280 YGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSIT 438 YGA + TF VR LQVVC+I I+GMT NF++QMV ++ P +VGT+S+T Sbjct: 6 YGA--IGMTFKVVRMLQVVCLIAIIGMTANFISQMVSSNTTPPEVLVGTISVT 56 >ref|XP_001244998.1| hypothetical protein CIMG_04439 [Coccidioides immitis RS] gi|392867907|gb|EAS33620.2| hypothetical protein CIMG_04439 [Coccidioides immitis RS] Length = 192 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = +1 Query: 280 YGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSIT 438 YGA + TF VR LQVVC+I I+GMT NF++QMV ++ P +VGT+S+T Sbjct: 6 YGA--IGMTFKVVRMLQVVCLIAIIGMTANFISQMVSSNTTPPEVLVGTISVT 56 >gb|ELR02306.1| hypothetical protein GMDG_05375 [Pseudogymnoascus destructans 20631-21] Length = 184 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/58 (46%), Positives = 38/58 (65%) Frame = +1 Query: 265 MPIPSYGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSIT 438 MP P YGA L A++ RGLQ + +I I+GMT NF+ QMV + P ++GT+S+T Sbjct: 1 MPAPQYGA--LGASYTVARGLQGISLISIIGMTANFIAQMVSSKTNPPNVLIGTISVT 56 >ref|XP_002542150.1| conserved hypothetical protein [Uncinocarpus reesii 1704] gi|237902416|gb|EEP76817.1| conserved hypothetical protein [Uncinocarpus reesii 1704] Length = 197 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/53 (52%), Positives = 36/53 (67%) Frame = +1 Query: 280 YGAAPLSATFLGVRGLQVVCMIVILGMTGNFVNQMVMADHEPSREIVGTLSIT 438 YGA + TF VR LQ VC+I I+GMT NF++QMV + P +VGTLS+T Sbjct: 6 YGA--IGMTFKVVRMLQAVCLIAIIGMTANFISQMVSSSTSPPEVLVGTLSVT 56