BLASTX nr result
ID: Akebia25_contig00037014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00037014 (241 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003039064.1| hypothetical protein NECHADRAFT_56797 [Nectr... 69 5e-10 emb|CCE28842.1| related to H. sapiens F-box protein [Claviceps p... 69 9e-10 gb|EON65218.1| hypothetical protein W97_04455 [Coniosporium apol... 68 2e-09 gb|EXM23196.1| hypothetical protein FOTG_09493 [Fusarium oxyspor... 67 3e-09 gb|EXM23195.1| hypothetical protein FOTG_09493 [Fusarium oxyspor... 67 3e-09 gb|EXL85645.1| hypothetical protein FOPG_02457 [Fusarium oxyspor... 67 3e-09 gb|EXK87894.1| hypothetical protein FOQG_08762 [Fusarium oxyspor... 67 3e-09 gb|EXK87893.1| hypothetical protein FOQG_08762 [Fusarium oxyspor... 67 3e-09 gb|EXA46808.1| hypothetical protein FOVG_04127 [Fusarium oxyspor... 67 3e-09 gb|EXA46807.1| hypothetical protein FOVG_04127 [Fusarium oxyspor... 67 3e-09 gb|EWZ99992.1| hypothetical protein FOWG_00355 [Fusarium oxyspor... 67 3e-09 gb|EWZ99991.1| hypothetical protein FOWG_00355 [Fusarium oxyspor... 67 3e-09 gb|EWZ42926.1| hypothetical protein FOZG_07695 [Fusarium oxyspor... 67 3e-09 gb|EWZ42925.1| hypothetical protein FOZG_07695 [Fusarium oxyspor... 67 3e-09 gb|EWY95283.1| hypothetical protein FOYG_04377 [Fusarium oxyspor... 67 3e-09 gb|EWY95282.1| hypothetical protein FOYG_04377 [Fusarium oxyspor... 67 3e-09 gb|ENH69576.1| F-box protein pof7 [Fusarium oxysporum f. sp. cub... 67 3e-09 gb|EGU82776.1| hypothetical protein FOXB_06727 [Fusarium oxyspor... 67 3e-09 gb|EXM03408.1| hypothetical protein FOIG_06220 [Fusarium oxyspor... 67 3e-09 gb|EXM03407.1| hypothetical protein FOIG_06220 [Fusarium oxyspor... 67 3e-09 >ref|XP_003039064.1| hypothetical protein NECHADRAFT_56797 [Nectria haematococca mpVI 77-13-4] gi|302924542|ref|XP_003053912.1| hypothetical protein NECHADRAFT_75539 [Nectria haematococca mpVI 77-13-4] gi|256719804|gb|EEU33351.1| hypothetical protein NECHADRAFT_56797 [Nectria haematococca mpVI 77-13-4] gi|256734853|gb|EEU48199.1| hypothetical protein NECHADRAFT_75539 [Nectria haematococca mpVI 77-13-4] Length = 532 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 5/79 (6%) Frame = +2 Query: 17 VDWEDPVEQSLSRLALDH-----PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRI 181 ++W+D E+ + + P + A+R A ++A + SVYPT++ +FRSRPRI Sbjct: 279 IEWDDLPEEEQDDIEIVDGVIVGPAEIAQRRHADNLAYTESLTPSVYPTWKNLFRSRPRI 338 Query: 182 RFNGCYISTVNYTRPGAVA 238 RFNGCYISTVNY R G ++ Sbjct: 339 RFNGCYISTVNYVRTGQIS 357 >emb|CCE28842.1| related to H. sapiens F-box protein [Claviceps purpurea 20.1] Length = 568 Score = 68.6 bits (166), Expect = 9e-10 Identities = 38/75 (50%), Positives = 43/75 (57%), Gaps = 3/75 (4%) Frame = +2 Query: 14 TVDWED---PVEQSLSRLALDHPLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIR 184 T DW D P LSRL A+R + SL T YP+++ MFRSRPRIR Sbjct: 303 TTDWSDVSPPPPSLLSRLETSSTDVLAQRRNHSTALSKSLIGTPAYPSWKHMFRSRPRIR 362 Query: 185 FNGCYISTVNYTRPG 229 FNGCYISTVNY R G Sbjct: 363 FNGCYISTVNYIRMG 377 >gb|EON65218.1| hypothetical protein W97_04455 [Coniosporium apollinis CBS 100218] Length = 517 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/55 (61%), Positives = 37/55 (67%) Frame = +2 Query: 68 HPLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPGA 232 HP P+ A + A P YPTYR +F SRPRIRFNGCYISTVNYTRPGA Sbjct: 295 HPGTPSALTAATAAALIPRP----YPTYRALFHSRPRIRFNGCYISTVNYTRPGA 345 >gb|EXM23196.1| hypothetical protein FOTG_09493 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 502 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 272 PSELAQRKRDANIAFTESLIPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 324 >gb|EXM23195.1| hypothetical protein FOTG_09493 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 526 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 296 PSELAQRKRDANIAFTESLIPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 348 >gb|EXL85645.1| hypothetical protein FOPG_02457 [Fusarium oxysporum f. sp. conglutinans race 2 54008] Length = 502 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 272 PSELAQRKRDANIAFTESLIPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 324 >gb|EXK87894.1| hypothetical protein FOQG_08762 [Fusarium oxysporum f. sp. raphani 54005] Length = 502 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 272 PSELAQRKRDANIAFTESLIPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 324 >gb|EXK87893.1| hypothetical protein FOQG_08762 [Fusarium oxysporum f. sp. raphani 54005] Length = 526 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 296 PSELAQRKRDANIAFTESLIPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 348 >gb|EXA46808.1| hypothetical protein FOVG_04127 [Fusarium oxysporum f. sp. pisi HDV247] Length = 502 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 272 PSELAQRKRDANIAFTESLIPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 324 >gb|EXA46807.1| hypothetical protein FOVG_04127 [Fusarium oxysporum f. sp. pisi HDV247] Length = 526 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 296 PSELAQRKRDANIAFTESLIPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 348 >gb|EWZ99992.1| hypothetical protein FOWG_00355 [Fusarium oxysporum f. sp. lycopersici MN25] gi|591423526|gb|EXL58663.1| hypothetical protein FOCG_02153 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] Length = 502 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 272 PSELAQRKRDANIAFTESLIPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 324 >gb|EWZ99991.1| hypothetical protein FOWG_00355 [Fusarium oxysporum f. sp. lycopersici MN25] gi|591423525|gb|EXL58662.1| hypothetical protein FOCG_02153 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] Length = 526 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 296 PSELAQRKRDANIAFTESLIPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 348 >gb|EWZ42926.1| hypothetical protein FOZG_07695 [Fusarium oxysporum Fo47] Length = 502 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 272 PSELAQRKRDANIAFTESLIPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 324 >gb|EWZ42925.1| hypothetical protein FOZG_07695 [Fusarium oxysporum Fo47] Length = 526 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 296 PSELAQRKRDANIAFTESLIPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 348 >gb|EWY95283.1| hypothetical protein FOYG_04377 [Fusarium oxysporum FOSC 3-a] Length = 502 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 272 PSELAQRKRDANIAFTESLIPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 324 >gb|EWY95282.1| hypothetical protein FOYG_04377 [Fusarium oxysporum FOSC 3-a] Length = 526 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 296 PSELAQRKRDANIAFTESLIPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 348 >gb|ENH69576.1| F-box protein pof7 [Fusarium oxysporum f. sp. cubense race 1] Length = 526 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 296 PSELAQRKRDANIAFTESLIPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 348 >gb|EGU82776.1| hypothetical protein FOXB_06727 [Fusarium oxysporum Fo5176] gi|591453365|gb|EXL85644.1| hypothetical protein FOPG_02457 [Fusarium oxysporum f. sp. conglutinans race 2 54008] Length = 526 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 296 PSELAQRKRDANIAFTESLIPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 348 >gb|EXM03408.1| hypothetical protein FOIG_06220 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] Length = 502 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 272 PSELAQRKRDANIAFTESLVPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 324 >gb|EXM03407.1| hypothetical protein FOIG_06220 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] Length = 526 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 71 PLDPAERLTAHSVAPSSLPLTSVYPTYRQMFRSRPRIRFNGCYISTVNYTRPG 229 P + A+R ++A + + SVYPT++Q+FRSRPRIRFNGCYISTVNY R G Sbjct: 296 PSELAQRKRDANIAFTESLVPSVYPTWKQLFRSRPRIRFNGCYISTVNYVRTG 348