BLASTX nr result
ID: Akebia25_contig00036802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00036802 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEH45150.1| ER-derived vesicles protein ERV14 [Paracoccidioid... 96 5e-18 ref|XP_007594549.1| cornichon protein [Colletotrichum fioriniae ... 93 3e-17 gb|ETS75263.1| ER-derived vesicles protein ERV14 [Pestalotiopsis... 93 3e-17 gb|ERS98484.1| hypothetical protein HMPREF1624_05268 [Sporothrix... 93 3e-17 gb|EPE04467.1| er-derived vesicles protein erv14 [Ophiostoma pic... 93 3e-17 gb|EON97089.1| putative er-derived vesicles protein erv14 protei... 93 3e-17 gb|EMR63120.1| putative er-derived vesicles protein erv14 protei... 93 3e-17 gb|EGY17451.1| ER-derived vesicles protein ERV14 [Verticillium d... 93 3e-17 gb|EGO55148.1| hypothetical protein NEUTE1DRAFT_139416 [Neurospo... 93 3e-17 gb|EFX05576.1| endosomal cargo receptor [Grosmannia clavigera kw... 93 3e-17 ref|XP_003345709.1| hypothetical protein SMAC_05866 [Sordaria ma... 93 3e-17 ref|XP_959269.1| hypothetical protein NCU06922 [Neurospora crass... 93 3e-17 gb|EJT80101.1| hypothetical protein GGTG_00105 [Gaeumannomyces g... 93 4e-17 gb|EFQ31891.1| cornichon protein [Colletotrichum graminicola M1.... 93 4e-17 ref|XP_003715094.1| hypothetical protein MGG_08132 [Magnaporthe ... 93 4e-17 ref|XP_001227715.1| hypothetical protein CHGG_09788 [Chaetomium ... 92 6e-17 ref|XP_003665096.1| hypothetical protein MYCTH_2315877 [Myceliop... 92 6e-17 ref|XP_003654477.1| hypothetical protein THITE_2117543 [Thielavi... 92 6e-17 ref|XP_006692282.1| hypothetical protein CTHT_0017820 [Chaetomiu... 92 6e-17 emb|CCF38491.1| ER-derived vesicles protein ERV14 [Colletotrichu... 91 1e-16 >gb|EEH45150.1| ER-derived vesicles protein ERV14 [Paracoccidioides brasiliensis Pb18] Length = 305 Score = 95.9 bits (237), Expect = 5e-18 Identities = 47/59 (79%), Positives = 50/59 (84%) Frame = -1 Query: 179 IHLHHPVL*SRTLVTMSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 IH HP L R+ MSGEAWLYL +VLINAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 154 IHTAHP-LRKRSAAIMSGEAWLYLLSVLINAVNLFLQVFFTIMYSDLECDYINPIDLCN 211 >ref|XP_007594549.1| cornichon protein [Colletotrichum fioriniae PJ7] gi|588901344|gb|EXF81832.1| cornichon protein [Colletotrichum fioriniae PJ7] Length = 138 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >gb|ETS75263.1| ER-derived vesicles protein ERV14 [Pestalotiopsis fici W106-1] Length = 138 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >gb|ERS98484.1| hypothetical protein HMPREF1624_05268 [Sporothrix schenckii ATCC 58251] Length = 138 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >gb|EPE04467.1| er-derived vesicles protein erv14 [Ophiostoma piceae UAMH 11346] Length = 138 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >gb|EON97089.1| putative er-derived vesicles protein erv14 protein [Togninia minima UCRPA7] Length = 138 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >gb|EMR63120.1| putative er-derived vesicles protein erv14 protein [Eutypa lata UCREL1] Length = 138 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >gb|EGY17451.1| ER-derived vesicles protein ERV14 [Verticillium dahliae VdLs.17] Length = 138 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >gb|EGO55148.1| hypothetical protein NEUTE1DRAFT_139416 [Neurospora tetrasperma FGSC 2508] gi|350288401|gb|EGZ69637.1| cornichon [Neurospora tetrasperma FGSC 2509] Length = 138 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >gb|EFX05576.1| endosomal cargo receptor [Grosmannia clavigera kw1407] Length = 138 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >ref|XP_003345709.1| hypothetical protein SMAC_05866 [Sordaria macrospora k-hell] gi|380090045|emb|CCC12128.1| unnamed protein product [Sordaria macrospora k-hell] Length = 138 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >ref|XP_959269.1| hypothetical protein NCU06922 [Neurospora crassa OR74A] gi|553134241|gb|ESA41841.1| endosomal cargo receptor [Neurospora crassa OR74A] gi|553134242|gb|ESA41842.1| endosomal cargo receptor, variant [Neurospora crassa OR74A] Length = 138 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >gb|EJT80101.1| hypothetical protein GGTG_00105 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 138 Score = 92.8 bits (229), Expect = 4e-17 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAVL+NAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVLVNAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >gb|EFQ31891.1| cornichon protein [Colletotrichum graminicola M1.001] Length = 138 Score = 92.8 bits (229), Expect = 4e-17 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAVL+NAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVLVNAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >ref|XP_003715094.1| hypothetical protein MGG_08132 [Magnaporthe oryzae 70-15] gi|351647427|gb|EHA55287.1| hypothetical protein MGG_08132 [Magnaporthe oryzae 70-15] gi|440475589|gb|ELQ44258.1| hypothetical protein OOU_Y34scaffold00094g48 [Magnaporthe oryzae Y34] gi|440481850|gb|ELQ62387.1| hypothetical protein OOW_P131scaffold01076g16 [Magnaporthe oryzae P131] Length = 138 Score = 92.8 bits (229), Expect = 4e-17 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAVL+NAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVLVNAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >ref|XP_001227715.1| hypothetical protein CHGG_09788 [Chaetomium globosum CBS 148.51] gi|88175916|gb|EAQ83384.1| hypothetical protein CHGG_09788 [Chaetomium globosum CBS 148.51] Length = 643 Score = 92.4 bits (228), Expect = 6e-17 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAV+INAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVIINAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >ref|XP_003665096.1| hypothetical protein MYCTH_2315877 [Myceliophthora thermophila ATCC 42464] gi|347012367|gb|AEO59851.1| hypothetical protein MYCTH_2315877 [Myceliophthora thermophila ATCC 42464] Length = 138 Score = 92.4 bits (228), Expect = 6e-17 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAV+INAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVIINAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >ref|XP_003654477.1| hypothetical protein THITE_2117543 [Thielavia terrestris NRRL 8126] gi|347001740|gb|AEO68141.1| hypothetical protein THITE_2117543 [Thielavia terrestris NRRL 8126] Length = 138 Score = 92.4 bits (228), Expect = 6e-17 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAV+INAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVIINAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >ref|XP_006692282.1| hypothetical protein CTHT_0017820 [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340966756|gb|EGS22263.1| hypothetical protein CTHT_0017820 [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 138 Score = 92.4 bits (228), Expect = 6e-17 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWLYLFAV+INAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLYLFAVIINAVNLFLQVFFTIMYSDLECDYINPIDLCN 44 >emb|CCF38491.1| ER-derived vesicles protein ERV14 [Colletotrichum higginsianum] Length = 138 Score = 91.3 bits (225), Expect = 1e-16 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = -1 Query: 134 MSGEAWLYLFAVLINAVNLFLQVFFTIMYSDLECDYINPIDLCS 3 MSGEAWL+LFAVL+NAVNLFLQVFFTIMYSDLECDYINPIDLC+ Sbjct: 1 MSGEAWLFLFAVLVNAVNLFLQVFFTIMYSDLECDYINPIDLCN 44