BLASTX nr result
ID: Akebia25_contig00036777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00036777 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37086.3| unnamed protein product [Vitis vinifera] 59 7e-07 >emb|CBI37086.3| unnamed protein product [Vitis vinifera] Length = 771 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 1/69 (1%) Frame = +3 Query: 150 LEMANRSMKSFFNQLDSSINLLKKQDSYRWFLYSVLTRYKSQWSKV-DTNDAADSSEGKK 326 LEMANRS+ F+ + SS +L KKQD Y+ F+Y VL R +SQWSKV + + ++ E KK Sbjct: 212 LEMANRSIMRLFHSIYSSTHLPKKQDLYQRFVYGVLNRCQSQWSKVGEKVENNEAREAKK 271 Query: 327 LSSIPVISE 353 +PV +E Sbjct: 272 DLKLPVRAE 280