BLASTX nr result
ID: Akebia25_contig00036607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00036607 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJT73085.1| plasma membrane proteolipid 3 [Gaeumannomyces gra... 84 3e-14 ref|XP_003856424.1| hypothetical protein MYCGRDRAFT_78728 [Zymos... 84 3e-14 gb|EMF17724.1| UPF0057-domain-containing protein [Sphaerulina mu... 83 4e-14 gb|EME50198.1| hypothetical protein DOTSEDRAFT_41329 [Dothistrom... 83 5e-14 gb|EFX02834.1| stress response RCI peptide [Grosmannia clavigera... 82 6e-14 gb|EMC99051.1| hypothetical protein BAUCODRAFT_389265 [Baudoinia... 82 1e-13 gb|EME87335.1| hypothetical protein MYCFIDRAFT_180921 [Pseudocer... 81 1e-13 ref|XP_001875355.1| predicted protein [Laccaria bicolor S238N-H8... 80 2e-13 emb|CCU76326.1| plasma membrane proteolipid 3 [Blumeria graminis... 80 3e-13 gb|ELR05278.1| plasma membrane proteolipid 3 [Pseudogymnoascus d... 80 3e-13 ref|XP_007288375.1| plasma membrane proteolipid 3 [Marssonina br... 80 3e-13 ref|XP_002171655.1| predicted protein [Schizosaccharomyces japon... 80 3e-13 ref|XP_007338654.1| UPF0057-domain-containing protein [Auricular... 80 4e-13 ref|XP_569421.1| cation transport-related protein [Cryptococcus ... 79 5e-13 gb|ETW85769.1| putative stress-induced hydrophobic peptide [Hete... 79 7e-13 ref|XP_001588788.1| hypothetical protein SS1G_10335 [Sclerotinia... 79 7e-13 ref|XP_003719726.1| plasma membrane proteolipid 3 [Magnaporthe o... 79 7e-13 emb|CCC12470.1| unnamed protein product [Sordaria macrospora k-h... 79 9e-13 ref|XP_001547873.1| conserved hypothetical protein [Botryotinia ... 79 9e-13 gb|ERS97669.1| plasma membrane proteolipid 3 [Sporothrix schenck... 78 1e-12 >gb|EJT73085.1| plasma membrane proteolipid 3 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 83 Score = 83.6 bits (205), Expect = 3e-14 Identities = 43/73 (58%), Positives = 53/73 (72%), Gaps = 3/73 (4%) Frame = -2 Query: 328 SP*HPQNLPQHNTAA---MAGSDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGY 158 SP H Q P +T A SD+ IILA+ +PPLGVF +R CG DLLINILLT+LGY Sbjct: 11 SPKHKQTQPDTDTPANMPFTASDICKIILAVILPPLGVFL-ERGCGADLLINILLTLLGY 69 Query: 157 IPGIIHALYVVLR 119 +PGIIHALY++L+ Sbjct: 70 LPGIIHALYIILK 82 >ref|XP_003856424.1| hypothetical protein MYCGRDRAFT_78728 [Zymoseptoria tritici IPO323] gi|339476309|gb|EGP91400.1| hypothetical protein MYCGRDRAFT_78728 [Zymoseptoria tritici IPO323] Length = 57 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/53 (73%), Positives = 47/53 (88%) Frame = -2 Query: 277 GSDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 GSD++ II AIF+PP+GVF +R CG DLLINILLTILGYIPGIIHALY++L+ Sbjct: 5 GSDIIKIIFAIFIPPIGVFL-ERGCGADLLINILLTILGYIPGIIHALYIILK 56 >gb|EMF17724.1| UPF0057-domain-containing protein [Sphaerulina musiva SO2202] Length = 57 Score = 83.2 bits (204), Expect = 4e-14 Identities = 39/53 (73%), Positives = 47/53 (88%) Frame = -2 Query: 277 GSDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 GSD++ II AIF+PP+GVF +R CG DLLINILLTILGYIPGIIHALY++L+ Sbjct: 5 GSDIIKIIFAIFIPPVGVFL-ERGCGADLLINILLTILGYIPGIIHALYIILK 56 >gb|EME50198.1| hypothetical protein DOTSEDRAFT_41329 [Dothistroma septosporum NZE10] Length = 57 Score = 82.8 bits (203), Expect = 5e-14 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -2 Query: 277 GSDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 GSD++ IILAI +PPLGVF +R CG DLLINILLTILGYIPGIIHALY++L+ Sbjct: 5 GSDIIKIILAILLPPLGVFL-ERGCGADLLINILLTILGYIPGIIHALYIILK 56 >gb|EFX02834.1| stress response RCI peptide [Grosmannia clavigera kw1407] Length = 57 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/56 (71%), Positives = 48/56 (85%) Frame = -2 Query: 286 AMAGSDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 A+ GSD+ IILAI +PPLGVF +R CG DLLINILLTILGY+PGIIHALY++L+ Sbjct: 2 AVTGSDICKIILAIILPPLGVFL-ERGCGADLLINILLTILGYLPGIIHALYIILK 56 >gb|EMC99051.1| hypothetical protein BAUCODRAFT_389265 [Baudoinia compniacensis UAMH 10762] Length = 57 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/53 (73%), Positives = 47/53 (88%) Frame = -2 Query: 277 GSDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 GSD++ II+AI +PPLGVF +R CG DLLINILLTILGYIPGIIHALY++L+ Sbjct: 5 GSDIIKIIVAILLPPLGVFL-ERGCGADLLINILLTILGYIPGIIHALYIILK 56 >gb|EME87335.1| hypothetical protein MYCFIDRAFT_180921 [Pseudocercospora fijiensis CIRAD86] Length = 57 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = -2 Query: 277 GSDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 GSD++ II AI +PPLGVF +R CG DLLINILLTILGYIPGIIHALY++L+ Sbjct: 5 GSDIIKIIFAILLPPLGVFL-ERGCGADLLINILLTILGYIPGIIHALYIILK 56 >ref|XP_001875355.1| predicted protein [Laccaria bicolor S238N-H82] gi|164650555|gb|EDR14796.1| predicted protein [Laccaria bicolor S238N-H82] Length = 57 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = -2 Query: 274 SDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 SD+ I++AIF+PPLGVF +R CG DLLINILLTILGYIPGIIHALY++L+ Sbjct: 6 SDICKILIAIFIPPLGVFL-ERGCGADLLINILLTILGYIPGIIHALYIILK 56 >emb|CCU76326.1| plasma membrane proteolipid 3 [Blumeria graminis f. sp. hordei DH14] Length = 57 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -2 Query: 274 SDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 SD+ IILA+ +PPLGVF +R CGPDLLINILLTILGYIPGIIHALY++ + Sbjct: 6 SDIFKIILAVILPPLGVFL-ERGCGPDLLINILLTILGYIPGIIHALYIIFK 56 >gb|ELR05278.1| plasma membrane proteolipid 3 [Pseudogymnoascus destructans 20631-21] Length = 57 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = -2 Query: 286 AMAGSDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 A SD+ IILAIF+PP+GVF +R CG D LINILLTILGYIPGIIHALY++L+ Sbjct: 2 AFTASDICKIILAIFLPPVGVFL-ERGCGADFLINILLTILGYIPGIIHALYIILK 56 >ref|XP_007288375.1| plasma membrane proteolipid 3 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406868336|gb|EKD21373.1| plasma membrane proteolipid 3 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 57 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = -2 Query: 286 AMAGSDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 A SD+ IILA+ +PPLGVF +R CG DLLINILLTILGYIPGIIHALY++L+ Sbjct: 2 AFTASDICKIILAVILPPLGVFL-ERGCGADLLINILLTILGYIPGIIHALYIILK 56 >ref|XP_002171655.1| predicted protein [Schizosaccharomyces japonicus yFS275] gi|211999702|gb|EEB05362.1| plasma membrane proteolipid Pmp3 [Schizosaccharomyces japonicus yFS275] Length = 57 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/56 (67%), Positives = 47/56 (83%) Frame = -2 Query: 286 AMAGSDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 A+ GSD++ II AIF+PP+GVF +R CG DLLINILL LGYIPGIIHALY++L+ Sbjct: 2 ALTGSDIIKIICAIFLPPVGVFL-ERGCGADLLINILLCCLGYIPGIIHALYIILK 56 >ref|XP_007338654.1| UPF0057-domain-containing protein [Auricularia delicata TFB-10046 SS5] gi|393245561|gb|EJD53071.1| UPF0057-domain-containing protein [Auricularia delicata TFB-10046 SS5] Length = 57 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/56 (66%), Positives = 46/56 (82%) Frame = -2 Query: 286 AMAGSDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 A GSD+ I+ AI +PPLGVF+ +R CG D LINILLT+LGYIPGIIHALY++L+ Sbjct: 2 AFTGSDICKILFAILLPPLGVFF-ERGCGADFLINILLTVLGYIPGIIHALYIILK 56 >ref|XP_569421.1| cation transport-related protein [Cryptococcus neoformans var. neoformans JEC21] gi|338819203|sp|P0CS19.1|PMP3_CRYNB RecName: Full=Plasma membrane proteolipid 3 gi|338819204|sp|P0CS18.1|PMP3_CRYNJ RecName: Full=Plasma membrane proteolipid 3 gi|57225653|gb|AAW42114.1| cation transport-related protein, putative [Cryptococcus neoformans var. neoformans JEC21] Length = 57 Score = 79.3 bits (194), Expect = 5e-13 Identities = 40/56 (71%), Positives = 46/56 (82%) Frame = -2 Query: 286 AMAGSDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 A SD+ IILAI +PPLGVF +R CG DLLINILLTILGYIPGIIHALY++L+ Sbjct: 2 AFTCSDIFKIILAIILPPLGVFL-ERGCGADLLINILLTILGYIPGIIHALYIILK 56 >gb|ETW85769.1| putative stress-induced hydrophobic peptide [Heterobasidion irregulare TC 32-1] Length = 57 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/56 (66%), Positives = 46/56 (82%) Frame = -2 Query: 286 AMAGSDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 A GSD+ II A+ +PP+GVF +R CG DL+INILLTILGYIPGIIHALY++L+ Sbjct: 2 AFTGSDICKIIFAVLLPPIGVFL-ERGCGADLVINILLTILGYIPGIIHALYIILK 56 >ref|XP_001588788.1| hypothetical protein SS1G_10335 [Sclerotinia sclerotiorum 1980] gi|154694724|gb|EDN94462.1| hypothetical protein SS1G_10335 [Sclerotinia sclerotiorum 1980 UF-70] Length = 57 Score = 79.0 bits (193), Expect = 7e-13 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -2 Query: 274 SDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 SD+ IILAI +PPLGVF +R CG DLLINILLTILGYIPGIIHALY++L+ Sbjct: 6 SDICKIILAIILPPLGVFL-ERGCGADLLINILLTILGYIPGIIHALYIILK 56 >ref|XP_003719726.1| plasma membrane proteolipid 3 [Magnaporthe oryzae 70-15] gi|351639495|gb|EHA47359.1| plasma membrane proteolipid 3 [Magnaporthe oryzae 70-15] gi|440472934|gb|ELQ41764.1| hypothetical protein OOU_Y34scaffold00255g62 [Magnaporthe oryzae Y34] gi|440478702|gb|ELQ59512.1| hypothetical protein OOW_P131scaffold01349g18 [Magnaporthe oryzae P131] Length = 57 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -2 Query: 274 SDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 SD+ IILA+ +PPLGVF +R CG DLLINILLTILGYIPGIIHALY++L+ Sbjct: 6 SDICKIILAVILPPLGVFM-ERGCGADLLINILLTILGYIPGIIHALYIILK 56 >emb|CCC12470.1| unnamed protein product [Sordaria macrospora k-hell] Length = 57 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/56 (66%), Positives = 46/56 (82%) Frame = -2 Query: 286 AMAGSDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 A SD+ II+AI +PPLGVF+ +R CG DL INILLTILGYIPGI+HALY++L+ Sbjct: 2 AFTASDICKIIVAIILPPLGVFF-ERGCGADLFINILLTILGYIPGIVHALYIILK 56 >ref|XP_001547873.1| conserved hypothetical protein [Botryotinia fuckeliana B05.10] gi|347835463|emb|CCD50035.1| similar to stress response RCI peptide [Botryotinia fuckeliana T4] Length = 57 Score = 78.6 bits (192), Expect = 9e-13 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -2 Query: 274 SDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 SD+ IILA+ +PPLGVF +R CG DLLINILLTILGYIPGIIHALY++L+ Sbjct: 6 SDICKIILAVILPPLGVFL-ERGCGADLLINILLTILGYIPGIIHALYIILK 56 >gb|ERS97669.1| plasma membrane proteolipid 3 [Sporothrix schenckii ATCC 58251] Length = 57 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -2 Query: 274 SDLVSIILAIFVPPLGVFWKQRRCGPDLLINILLTILGYIPGIIHALYVVLR 119 SD+ IILAI +PPLGVF +R CG DLLINILLTILGYIPGI+HALY++L+ Sbjct: 6 SDICKIILAIILPPLGVFL-ERGCGADLLINILLTILGYIPGILHALYIILK 56