BLASTX nr result
ID: Akebia25_contig00036448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00036448 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006597358.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_003545705.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_003531533.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_002268952.2| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 emb|CBI40661.3| unnamed protein product [Vitis vinifera] 59 5e-07 gb|EYU18441.1| hypothetical protein MIMGU_mgv1a007532mg [Mimulus... 59 7e-07 ref|XP_004499170.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 gb|EXB57865.1| hypothetical protein L484_001062 [Morus notabilis] 57 2e-06 gb|AFK33523.1| unknown [Lotus japonicus] 56 5e-06 ref|XP_002522615.1| pentatricopeptide repeat-containing protein,... 56 6e-06 ref|XP_006287851.1| hypothetical protein CARUB_v10001077mg [Caps... 55 8e-06 ref|XP_006287850.1| hypothetical protein CARUB_v10001077mg [Caps... 55 8e-06 ref|XP_004136896.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 ref|NP_568214.1| pentatricopeptide repeat-containing protein [Ar... 55 8e-06 gb|AAM64472.1| unknown [Arabidopsis thaliana] 55 8e-06 emb|CAC05471.1| putative protein [Arabidopsis thaliana] 55 8e-06 >ref|XP_006597358.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial-like isoform X2 [Glycine max] Length = 394 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 2/52 (3%) Frame = -3 Query: 150 RQLSSIALKSDHFEESK--DVDLKSRIFRLRFPKRSATNALQKWISEGNKVT 1 R +SS A+ SD EES D DL+SRIFRLR PKRSATN LQKW+ +GN +T Sbjct: 24 RFVSSGAVSSDLVEESVEGDDDLRSRIFRLRLPKRSATNVLQKWVLQGNPIT 75 >ref|XP_003545705.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial-like isoform X1 [Glycine max] Length = 399 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 2/52 (3%) Frame = -3 Query: 150 RQLSSIALKSDHFEESK--DVDLKSRIFRLRFPKRSATNALQKWISEGNKVT 1 R +SS A+ SD EES D DL+SRIFRLR PKRSATN LQKW+ +GN +T Sbjct: 29 RFVSSGAVSSDLVEESVEGDDDLRSRIFRLRLPKRSATNVLQKWVLQGNPIT 80 >ref|XP_003531533.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial-like [Glycine max] Length = 395 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/53 (64%), Positives = 39/53 (73%), Gaps = 3/53 (5%) Frame = -3 Query: 150 RQLSSIALKSDHFEESK---DVDLKSRIFRLRFPKRSATNALQKWISEGNKVT 1 R +SS A+ SD EES D DL+SRIFRLR PKRSATN LQKW+ +GN VT Sbjct: 24 RFVSSGAVSSDLVEESVEGVDDDLRSRIFRLRLPKRSATNVLQKWVLQGNPVT 76 >ref|XP_002268952.2| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial [Vitis vinifera] Length = 396 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/53 (58%), Positives = 39/53 (73%), Gaps = 4/53 (7%) Frame = -3 Query: 150 RQLSSIALKSDHFEES----KDVDLKSRIFRLRFPKRSATNALQKWISEGNKV 4 R LSS L+S+ EES ++ DLKSRIF+LR PKRS TN LQ+W+ EGN+V Sbjct: 22 RLLSSRTLRSEVLEESPNSPENDDLKSRIFKLRLPKRSVTNVLQRWLGEGNQV 74 >emb|CBI40661.3| unnamed protein product [Vitis vinifera] Length = 287 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/53 (58%), Positives = 39/53 (73%), Gaps = 4/53 (7%) Frame = -3 Query: 150 RQLSSIALKSDHFEES----KDVDLKSRIFRLRFPKRSATNALQKWISEGNKV 4 R LSS L+S+ EES ++ DLKSRIF+LR PKRS TN LQ+W+ EGN+V Sbjct: 29 RLLSSRTLRSEVLEESPNSPENDDLKSRIFKLRLPKRSVTNVLQRWLGEGNQV 81 >gb|EYU18441.1| hypothetical protein MIMGU_mgv1a007532mg [Mimulus guttatus] Length = 404 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -3 Query: 123 SDHFEESKDVDLKSRIFRLRFPKRSATNALQKWISEGNKVT 1 +D F E ++ DLKSRIFRLR PKRS +N LQKW++EG+++T Sbjct: 45 ADDFAEDENDDLKSRIFRLRLPKRSVSNVLQKWVNEGHQIT 85 >ref|XP_004499170.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial-like [Cicer arietinum] Length = 407 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 5/54 (9%) Frame = -3 Query: 150 RQLSSIALKSDHFEESK-----DVDLKSRIFRLRFPKRSATNALQKWISEGNKV 4 R +SS A+ SD+ EE+ D DL+SRI RLR PKRSATN LQKWI +GN + Sbjct: 34 RFVSSGAVTSDYVEETPNSAEGDDDLRSRILRLRLPKRSATNVLQKWILQGNSI 87 >gb|EXB57865.1| hypothetical protein L484_001062 [Morus notabilis] Length = 203 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 2/52 (3%) Frame = -3 Query: 150 RQLSSIALKSDHFEES--KDVDLKSRIFRLRFPKRSATNALQKWISEGNKVT 1 R S L+S EE + D+KSRIFRLR PKRSATN LQ+WISEGN+++ Sbjct: 120 RMFCSGTLRSYFVEEDSVESDDVKSRIFRLRLPKRSATNVLQRWISEGNQIS 171 >gb|AFK33523.1| unknown [Lotus japonicus] Length = 358 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = -3 Query: 150 RQLSSIALKSDHFEESKDVDLKSRIFRLRFPKRSATNALQKWISEGNKVT 1 R +SS A+ +D F ES D DL+SRI RLR PKRSATN L KW+ EGN VT Sbjct: 34 RFVSSGAVSTD-FVESDD-DLRSRILRLRLPKRSATNILHKWVLEGNSVT 81 >ref|XP_002522615.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538091|gb|EEF39702.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 426 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/53 (58%), Positives = 38/53 (71%), Gaps = 5/53 (9%) Frame = -3 Query: 144 LSSIALKSDHFEE---SKDV--DLKSRIFRLRFPKRSATNALQKWISEGNKVT 1 LSS L+++ E SK++ DLKSRIFRLR PKRSATN + W+SEGN VT Sbjct: 53 LSSGTLRNEVLAEESSSKEIEDDLKSRIFRLRLPKRSATNIIHNWVSEGNTVT 105 >ref|XP_006287851.1| hypothetical protein CARUB_v10001077mg [Capsella rubella] gi|482556557|gb|EOA20749.1| hypothetical protein CARUB_v10001077mg [Capsella rubella] Length = 412 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = -3 Query: 132 ALKSDHFEESKDVDLKSRIFRLRFPKRSATNALQKWISEGNKVT 1 +L + E + DL+SRIFRLR PKRSAT L+KW+ EGN++T Sbjct: 47 SLVDESLESEEKDDLRSRIFRLRLPKRSATTVLEKWVGEGNQIT 90 >ref|XP_006287850.1| hypothetical protein CARUB_v10001077mg [Capsella rubella] gi|482556556|gb|EOA20748.1| hypothetical protein CARUB_v10001077mg [Capsella rubella] Length = 401 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = -3 Query: 132 ALKSDHFEESKDVDLKSRIFRLRFPKRSATNALQKWISEGNKVT 1 +L + E + DL+SRIFRLR PKRSAT L+KW+ EGN++T Sbjct: 36 SLVDESLESEEKDDLRSRIFRLRLPKRSATTVLEKWVGEGNQIT 79 >ref|XP_004136896.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial-like [Cucumis sativus] gi|449478839|ref|XP_004155431.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial-like [Cucumis sativus] Length = 406 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 4/48 (8%) Frame = -3 Query: 132 ALKSDHFEESKDV----DLKSRIFRLRFPKRSATNALQKWISEGNKVT 1 AL+S+ F+ES + DLKSRIF+LR PKRSA L++W SEGN+VT Sbjct: 40 ALRSESFDESVNYEEFNDLKSRIFQLRLPKRSAIRVLERWTSEGNQVT 87 >ref|NP_568214.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75165070|sp|Q94B59.1|PP372_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g09450, mitochondrial; Flags: Precursor gi|14596093|gb|AAK68774.1| putative protein [Arabidopsis thaliana] gi|27311913|gb|AAO00922.1| putative protein [Arabidopsis thaliana] gi|332004012|gb|AED91395.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 409 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 108 ESKDVDLKSRIFRLRFPKRSATNALQKWISEGNKVT 1 E KD DLKSRIFRLR PKRSAT L+KWI EGN++T Sbjct: 52 EEKD-DLKSRIFRLRLPKRSATTVLEKWIGEGNQMT 86 >gb|AAM64472.1| unknown [Arabidopsis thaliana] Length = 409 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 108 ESKDVDLKSRIFRLRFPKRSATNALQKWISEGNKVT 1 E KD DLKSRIFRLR PKRSAT L+KWI EGN++T Sbjct: 52 EEKD-DLKSRIFRLRLPKRSATTVLEKWIGEGNQMT 86 >emb|CAC05471.1| putative protein [Arabidopsis thaliana] Length = 402 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 108 ESKDVDLKSRIFRLRFPKRSATNALQKWISEGNKVT 1 E KD DLKSRIFRLR PKRSAT L+KWI EGN++T Sbjct: 52 EEKD-DLKSRIFRLRLPKRSATTVLEKWIGEGNQMT 86