BLASTX nr result
ID: Akebia25_contig00036250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00036250 (212 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006827034.1| hypothetical protein AMTR_s00010p00224530 [A... 60 3e-07 ref|XP_006827035.1| hypothetical protein AMTR_s00010p00225110 [A... 59 9e-07 ref|XP_006827036.1| hypothetical protein AMTR_s00010p00225250 [A... 58 1e-06 ref|XP_006842722.1| hypothetical protein AMTR_s01360p00009540 [A... 57 2e-06 ref|XP_002266123.1| PREDICTED: uncharacterized protein LOC100254... 57 2e-06 ref|XP_002271703.2| PREDICTED: uncharacterized protein LOC100261... 56 6e-06 >ref|XP_006827034.1| hypothetical protein AMTR_s00010p00224530 [Amborella trichopoda] gi|548831463|gb|ERM94271.1| hypothetical protein AMTR_s00010p00224530 [Amborella trichopoda] Length = 330 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/66 (40%), Positives = 41/66 (62%) Frame = -1 Query: 206 NPSILTCDVDNCLTPNVNFLRSLLHTDENIVRFLKRSGWILNFDLRKLIACKFAILRQCG 27 +P ILT + + P + FL++ LHT+E +VR LK+S WIL FD++K + +L G Sbjct: 87 DPVILTKSTEKQILPKIEFLKNYLHTNEKVVRALKKSSWILIFDIQKRLVPNIRLLESYG 146 Query: 26 VPDKRI 9 V D R+ Sbjct: 147 VEDSRL 152 >ref|XP_006827035.1| hypothetical protein AMTR_s00010p00225110 [Amborella trichopoda] gi|548831464|gb|ERM94272.1| hypothetical protein AMTR_s00010p00225110 [Amborella trichopoda] Length = 330 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/66 (39%), Positives = 41/66 (62%) Frame = -1 Query: 206 NPSILTCDVDNCLTPNVNFLRSLLHTDENIVRFLKRSGWILNFDLRKLIACKFAILRQCG 27 +P ILT + + P + FL++ LHT+E +VR LK+S WIL FD++K + +L G Sbjct: 87 DPVILTKSTEKQILPKIEFLKNYLHTNEKVVRALKKSSWILIFDIQKRLVPNIRLLESYG 146 Query: 26 VPDKRI 9 V D ++ Sbjct: 147 VDDSQL 152 >ref|XP_006827036.1| hypothetical protein AMTR_s00010p00225250 [Amborella trichopoda] gi|586643976|ref|XP_006827037.1| hypothetical protein AMTR_s00010p00225430 [Amborella trichopoda] gi|548831465|gb|ERM94273.1| hypothetical protein AMTR_s00010p00225250 [Amborella trichopoda] gi|548831466|gb|ERM94274.1| hypothetical protein AMTR_s00010p00225430 [Amborella trichopoda] Length = 328 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/66 (40%), Positives = 39/66 (59%) Frame = -1 Query: 206 NPSILTCDVDNCLTPNVNFLRSLLHTDENIVRFLKRSGWILNFDLRKLIACKFAILRQCG 27 NP ILT + + P + L++ LHT+E +VR LKRS WIL FD+ K + +L G Sbjct: 87 NPVILTKSTEKQILPKIECLKNYLHTNEKVVRALKRSSWILIFDMEKRLVPNIRLLESYG 146 Query: 26 VPDKRI 9 V D ++ Sbjct: 147 VEDSQL 152 >ref|XP_006842722.1| hypothetical protein AMTR_s01360p00009540 [Amborella trichopoda] gi|548844824|gb|ERN04397.1| hypothetical protein AMTR_s01360p00009540 [Amborella trichopoda] Length = 330 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/66 (39%), Positives = 40/66 (60%) Frame = -1 Query: 206 NPSILTCDVDNCLTPNVNFLRSLLHTDENIVRFLKRSGWILNFDLRKLIACKFAILRQCG 27 +P ILT + + P + FL++ LHT+E +VR LK+S WIL FD+ K + +L G Sbjct: 87 DPVILTKSTEKQILPKLEFLKNYLHTNEKVVRALKKSSWILIFDIEKRLVPNIRLLESYG 146 Query: 26 VPDKRI 9 V D ++ Sbjct: 147 VEDSQL 152 >ref|XP_002266123.1| PREDICTED: uncharacterized protein LOC100254077 [Vitis vinifera] Length = 378 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/68 (39%), Positives = 44/68 (64%) Frame = -1 Query: 212 LKNPSILTCDVDNCLTPNVNFLRSLLHTDENIVRFLKRSGWILNFDLRKLIACKFAILRQ 33 + NP+IL +D + P+++FL+ L T+E IV +KR W+L+FDL+ ++ +L + Sbjct: 131 VSNPNILRRSLDKHIKPSLDFLKEFLETNEKIVTAIKRGSWLLSFDLKGILKPNTFLLIK 190 Query: 32 CGVPDKRI 9 GVP KRI Sbjct: 191 EGVPRKRI 198 >ref|XP_002271703.2| PREDICTED: uncharacterized protein LOC100261677 [Vitis vinifera] Length = 411 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/65 (44%), Positives = 40/65 (61%) Frame = -1 Query: 203 PSILTCDVDNCLTPNVNFLRSLLHTDENIVRFLKRSGWILNFDLRKLIACKFAILRQCGV 24 PSIL + N L P NFL+SL ++E+ V+ LKRS W + +L + IA A+LR+ GV Sbjct: 124 PSILRKSLKNVLIPKYNFLKSLNISNEDAVKVLKRSSWSSSGNLERTIAANIAVLREIGV 183 Query: 23 PDKRI 9 P I Sbjct: 184 PISHI 188