BLASTX nr result
ID: Akebia25_contig00036172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00036172 (275 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280741.1| PREDICTED: nuclear transcription factor Y su... 62 8e-08 ref|XP_002311837.2| hypothetical protein POPTR_0008s20780g [Popu... 60 2e-07 >ref|XP_002280741.1| PREDICTED: nuclear transcription factor Y subunit C-9-like [Vitis vinifera] Length = 262 Score = 62.0 bits (149), Expect = 8e-08 Identities = 38/84 (45%), Positives = 44/84 (52%), Gaps = 23/84 (27%) Frame = +1 Query: 1 REDLKDEV----PSGGTMPVGDLADPLPYYYMTPQLSAQ-------------------QS 111 REDLKDEV P GG +PVG A+ LPY+YM PQ Q Q Sbjct: 181 REDLKDEVLASIPRGGPLPVGGPAEGLPYFYMQPQHGPQVGAPGMVMGKTVMDQGLYGQQ 240 Query: 112 HHPYLTQQVYPQSLQHHQQPPADS 183 PY+ QQ++PQ Q QQPPADS Sbjct: 241 PRPYVAQQMWPQ--QQQQQPPADS 262 >ref|XP_002311837.2| hypothetical protein POPTR_0008s20780g [Populus trichocarpa] gi|550333559|gb|EEE89204.2| hypothetical protein POPTR_0008s20780g [Populus trichocarpa] Length = 226 Score = 60.5 bits (145), Expect = 2e-07 Identities = 37/83 (44%), Positives = 44/83 (53%), Gaps = 22/83 (26%) Frame = +1 Query: 1 REDLKDEVPSG---GTMPVGDLADPLPYYYMTPQLSAQ-------------------QSH 114 REDLKDEV + G++PVG AD LPYYYM PQL+ Q Q Sbjct: 147 REDLKDEVLASVPRGSLPVGGPADALPYYYMPPQLAPQVSAPGMTVGKPVVDQAFYGQQS 206 Query: 115 HPYLTQQVYPQSLQHHQQPPADS 183 PY+ QQ++PQ QQPP DS Sbjct: 207 RPYVPQQIWPQQT---QQPPEDS 226