BLASTX nr result
ID: Akebia25_contig00036002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00036002 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22851.1| hypothetical protein MIMGU_mgv1a002395mg [Mimulus... 57 3e-06 ref|XP_006851237.1| hypothetical protein AMTR_s00180p00023300 [A... 57 4e-06 >gb|EYU22851.1| hypothetical protein MIMGU_mgv1a002395mg [Mimulus guttatus] Length = 680 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 262 LNMFKDCERRAIAKLFHHRSEEKQTIPLQVTE 167 LNMFKDCERR IAKL+HHRSEE++ IPL TE Sbjct: 649 LNMFKDCERRKIAKLYHHRSEERRNIPLHETE 680 >ref|XP_006851237.1| hypothetical protein AMTR_s00180p00023300 [Amborella trichopoda] gi|548854920|gb|ERN12818.1| hypothetical protein AMTR_s00180p00023300 [Amborella trichopoda] Length = 659 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -3 Query: 259 NMFKDCERRAIAKLFHHRSEEKQTIPLQ 176 NMFKDCERR+IAKLFHHRSEEK+ +PLQ Sbjct: 629 NMFKDCERRSIAKLFHHRSEEKRNLPLQ 656