BLASTX nr result
ID: Akebia25_contig00035973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00035973 (812 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS60091.1| Retinoblastoma-related protein 1 [Triticum urartu] 49 6e-06 >gb|EMS60091.1| Retinoblastoma-related protein 1 [Triticum urartu] Length = 747 Score = 48.5 bits (114), Expect(2) = 6e-06 Identities = 22/41 (53%), Positives = 30/41 (73%) Frame = -3 Query: 264 KSWVVKVRYSFGELCDKHLPIKL*GKIYKIVVRPIMIYGAD 142 K+ +K R +FG LCDK +P KL GK Y++ VRP M+YGA+ Sbjct: 168 KAGWMKWRQAFGILCDKRVPQKLKGKFYRMTVRPAMLYGAE 208 Score = 28.5 bits (62), Expect(2) = 6e-06 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -1 Query: 284 KDVSHRIKAGWLK 246 +DV+HRIKAGW+K Sbjct: 161 EDVNHRIKAGWMK 173