BLASTX nr result
ID: Akebia25_contig00035883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00035883 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270524.1| PREDICTED: U-box domain-containing protein 1... 64 3e-08 ref|XP_007009958.1| U-box domain-containing protein 14 [Theobrom... 60 3e-07 ref|XP_003556245.1| PREDICTED: U-box domain-containing protein 1... 59 5e-07 ref|XP_006436481.1| hypothetical protein CICLE_v10030962mg [Citr... 57 2e-06 ref|XP_007143751.1| hypothetical protein PHAVU_007G098700g [Phas... 57 3e-06 ref|XP_004496239.1| PREDICTED: U-box domain-containing protein 1... 57 3e-06 ref|XP_003535520.1| PREDICTED: U-box domain-containing protein 1... 57 3e-06 ref|XP_002311996.1| armadillo/beta-catenin repeat family protein... 56 4e-06 gb|AFK37700.1| unknown [Lotus japonicus] 56 6e-06 >ref|XP_002270524.1| PREDICTED: U-box domain-containing protein 14 [Vitis vinifera] Length = 628 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +1 Query: 250 DQVFEIVKEISGFSECQNTSKKLYSNLLRRVKLLSPLFEEL 372 +Q+ +VKEISG EC+NT+KK+Y NL+RRVKLLSPLFEEL Sbjct: 14 NQLLAVVKEISGLPECRNTTKKMYYNLVRRVKLLSPLFEEL 54 >ref|XP_007009958.1| U-box domain-containing protein 14 [Theobroma cacao] gi|508726871|gb|EOY18768.1| U-box domain-containing protein 14 [Theobroma cacao] Length = 637 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = +1 Query: 223 TSTS*SETFDQVFEIVKEISGFSECQNTSKKLYSNLLRRVKLLSPLFEEL 372 T S E Q+ E+VKEI+G +C+N+ KK + NL+RR+KLLSPLFEEL Sbjct: 6 TGDSKGELLSQLAELVKEITGLPDCKNSCKKTHGNLVRRIKLLSPLFEEL 55 >ref|XP_003556245.1| PREDICTED: U-box domain-containing protein 14-like [Glycine max] Length = 631 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +1 Query: 253 QVFEIVKEISGFSECQNTSKKLYSNLLRRVKLLSPLFEEL 372 ++ E +KEISG ECQN K++Y NL+RRVKLLSPLFEEL Sbjct: 14 RLVECIKEISGLPECQNLCKRVYGNLVRRVKLLSPLFEEL 53 >ref|XP_006436481.1| hypothetical protein CICLE_v10030962mg [Citrus clementina] gi|568864439|ref|XP_006485606.1| PREDICTED: U-box domain-containing protein 14-like [Citrus sinensis] gi|557538677|gb|ESR49721.1| hypothetical protein CICLE_v10030962mg [Citrus clementina] Length = 627 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +1 Query: 238 SETFDQVFEIVKEISGFSECQNTSKKLYSNLLRRVKLLSPLFEEL 372 +E ++ + VKE+SG EC+N KK++ NL+RRVKLLSPLFEEL Sbjct: 8 AEVLSRLVDSVKEVSGLPECKNFFKKMHGNLVRRVKLLSPLFEEL 52 >ref|XP_007143751.1| hypothetical protein PHAVU_007G098700g [Phaseolus vulgaris] gi|561016941|gb|ESW15745.1| hypothetical protein PHAVU_007G098700g [Phaseolus vulgaris] Length = 631 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +1 Query: 253 QVFEIVKEISGFSECQNTSKKLYSNLLRRVKLLSPLFEEL 372 ++ E +K+ISG ECQN +++Y NL+RRVKLLSPLFEEL Sbjct: 14 RLVECIKDISGLLECQNFCRRVYGNLIRRVKLLSPLFEEL 53 >ref|XP_004496239.1| PREDICTED: U-box domain-containing protein 14-like [Cicer arietinum] Length = 630 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +1 Query: 250 DQVFEIVKEISGFSECQNTSKKLYSNLLRRVKLLSPLFEEL 372 +++ + +++ISG ECQN K++Y NL+RRVKLLSPLFEEL Sbjct: 13 NRLADSIRDISGLPECQNVCKRMYGNLIRRVKLLSPLFEEL 53 >ref|XP_003535520.1| PREDICTED: U-box domain-containing protein 14-like [Glycine max] Length = 632 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +1 Query: 253 QVFEIVKEISGFSECQNTSKKLYSNLLRRVKLLSPLFEEL 372 ++ E +KEISG E QN KK+Y NL+RRVKLLSPLFEEL Sbjct: 14 RLVECIKEISGLPESQNLCKKVYGNLVRRVKLLSPLFEEL 53 >ref|XP_002311996.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] gi|222851816|gb|EEE89363.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] Length = 628 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = +1 Query: 220 LTSTS*SETFDQVFEIVKEISGFSECQNTSKKLYSNLLRRVKLLSPLFEEL 372 LT SE ++ + VKEISG EC+N KK + +L+RR+KLLSP+FEEL Sbjct: 3 LTGDPSSELLSRLVDSVKEISGLPECRNVFKKTHGDLVRRIKLLSPMFEEL 53 >gb|AFK37700.1| unknown [Lotus japonicus] Length = 94 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = +1 Query: 238 SETFDQVFEIVKEISGFSECQNTSKKLYSNLLRRVKLLSPLFEEL 372 S + E +KEISG ECQN K++ N++RRVKLLSPLFEEL Sbjct: 9 SAVVGSLVETIKEISGLPECQNVHKRMCGNMVRRVKLLSPLFEEL 53