BLASTX nr result
ID: Akebia25_contig00035600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00035600 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137882.1| PREDICTED: ABC transporter C family member 1... 47 2e-06 emb|CAN69872.1| hypothetical protein VITISV_032285 [Vitis vinifera] 43 3e-06 emb|CAN59999.1| hypothetical protein VITISV_001733 [Vitis vinifera] 41 4e-06 ref|XP_006485859.1| PREDICTED: uncharacterized protein LOC102626... 39 6e-06 emb|CAN79196.1| hypothetical protein VITISV_000238 [Vitis vinifera] 40 6e-06 emb|CAH67874.1| OSIGBa0153E02-OSIGBa0093I20.3 [Oryza sativa Indi... 44 8e-06 emb|CAN73585.1| hypothetical protein VITISV_033960 [Vitis vinifera] 42 8e-06 >ref|XP_004137882.1| PREDICTED: ABC transporter C family member 13-like [Cucumis sativus] Length = 2377 Score = 47.4 bits (111), Expect(2) = 2e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +2 Query: 2 FFVVPHVFGCICFTHISSPAYTKLDPKTLKCVY 100 F + P +FGC+CF P +TKLDPK+LKC++ Sbjct: 1232 FPIAPKIFGCVCFVRDVRPHHTKLDPKSLKCIF 1264 Score = 30.0 bits (66), Expect(2) = 2e-06 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +3 Query: 93 VFIGYSNSQKGYICYHP 143 +F+GYS QKGY CY P Sbjct: 1263 IFLGYSRVQKGYRCYCP 1279 >emb|CAN69872.1| hypothetical protein VITISV_032285 [Vitis vinifera] Length = 843 Score = 42.7 bits (99), Expect(2) = 3e-06 Identities = 15/29 (51%), Positives = 21/29 (72%) Frame = +2 Query: 14 PHVFGCICFTHISSPAYTKLDPKTLKCVY 100 P +FGC+ F HI + TKLDP+ LKC++ Sbjct: 696 PRIFGCVAFVHIYAHQRTKLDPRALKCIF 724 Score = 33.9 bits (76), Expect(2) = 3e-06 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +3 Query: 93 VFIGYSNSQKGYICYHPPT*R 155 +F+GYS ++KGY CYHP + R Sbjct: 723 IFVGYSPTKKGYKCYHPASKR 743 >emb|CAN59999.1| hypothetical protein VITISV_001733 [Vitis vinifera] Length = 616 Score = 41.2 bits (95), Expect(2) = 4e-06 Identities = 15/21 (71%), Positives = 19/21 (90%) Frame = +3 Query: 93 VFIGYSNSQKGYICYHPPT*R 155 +F+GYS++QKGY CYHPPT R Sbjct: 95 IFVGYSSTQKGYKCYHPPTKR 115 Score = 35.0 bits (79), Expect(2) = 4e-06 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +2 Query: 20 VFGCICFTHISSPAYTKLDPKTLKCVY 100 VF CI F +I S + KLDP+ LKC++ Sbjct: 70 VFRCISFVYIHSNNHGKLDPRALKCIF 96 >ref|XP_006485859.1| PREDICTED: uncharacterized protein LOC102626627 [Citrus sinensis] Length = 1081 Score = 39.3 bits (90), Expect(2) = 6e-06 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +2 Query: 14 PHVFGCICFTHISSPAYTKLDPKTLKCVY 100 PHVFGC+ F H+ P KL P+ L+CV+ Sbjct: 406 PHVFGCVAFVHL--PQQDKLSPRALRCVF 432 Score = 36.2 bits (82), Expect(2) = 6e-06 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = +3 Query: 93 VFIGYSNSQKGYICYHPPT 149 VF+GY+ QKGY CYHPP+ Sbjct: 431 VFVGYALHQKGYRCYHPPS 449 >emb|CAN79196.1| hypothetical protein VITISV_000238 [Vitis vinifera] Length = 906 Score = 40.4 bits (93), Expect(2) = 6e-06 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +2 Query: 8 VVPHVFGCICFTHISSPAYTKLDPKTLKCVY 100 + P VFGC F H+ S KLDP+ +KCV+ Sbjct: 351 LTPRVFGCTAFVHVHSQHRDKLDPRAIKCVF 381 Score = 35.0 bits (79), Expect(2) = 6e-06 Identities = 13/19 (68%), Positives = 17/19 (89%) Frame = +3 Query: 93 VFIGYSNSQKGYICYHPPT 149 VF+GYS++QKGY CY+P T Sbjct: 380 VFLGYSSTQKGYKCYNPST 398 >emb|CAH67874.1| OSIGBa0153E02-OSIGBa0093I20.3 [Oryza sativa Indica Group] Length = 806 Score = 44.3 bits (103), Expect(2) = 8e-06 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +2 Query: 2 FFVVPHVFGCICFTHISSPAYTKLDPKTLKCVY 100 F V P VFGC+CF P+ KLDP+ +KC++ Sbjct: 30 FIVPPKVFGCVCFVRDHRPSVGKLDPRAIKCIF 62 Score = 30.8 bits (68), Expect(2) = 8e-06 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +3 Query: 93 VFIGYSNSQKGYICYHP 143 +FIGYS+ QKGY C+ P Sbjct: 61 IFIGYSSGQKGYKCWSP 77 >emb|CAN73585.1| hypothetical protein VITISV_033960 [Vitis vinifera] Length = 787 Score = 42.0 bits (97), Expect(2) = 8e-06 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 Query: 2 FFVVPHVFGCICFTHISSPAYTKLDPKTLKCVY 100 +F+ P VFGC CF H +P KL K KC++ Sbjct: 230 YFLPPRVFGCTCFVHTLTPGQDKLSAKATKCIF 262 Score = 33.1 bits (74), Expect(2) = 8e-06 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +3 Query: 93 VFIGYSNSQKGYICYHPPT*R 155 +F+GYS QKGY CY P T R Sbjct: 261 IFLGYSRLQKGYCCYSPNTHR 281