BLASTX nr result
ID: Akebia25_contig00035110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00035110 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30232.3| unnamed protein product [Vitis vinifera] 74 3e-11 ref|XP_002283772.1| PREDICTED: cytochrome P450 76A2 [Vitis vinif... 74 3e-11 emb|CAN76784.1| hypothetical protein VITISV_028823 [Vitis vinifera] 74 3e-11 ref|XP_002528645.1| cytochrome P450, putative [Ricinus communis]... 69 7e-10 ref|XP_004494132.1| PREDICTED: cytochrome P450 76A2-like [Cicer ... 66 4e-09 dbj|BAC53891.1| cytochrome P450 [Petunia x hybrida] 66 4e-09 ref|XP_003633930.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P... 66 6e-09 ref|XP_002271323.1| PREDICTED: cytochrome P450 76C1-like [Vitis ... 66 6e-09 emb|CAN81641.1| hypothetical protein VITISV_036425 [Vitis vinifera] 66 6e-09 ref|XP_002276053.1| PREDICTED: cytochrome P450 76C4-like [Vitis ... 65 7e-09 gb|EXC33898.1| Cytochrome P450 76A2 [Morus notabilis] 65 1e-08 gb|EXC06132.1| Cytochrome P450 76C4 [Morus notabilis] 65 1e-08 ref|XP_002283777.2| PREDICTED: cytochrome P450 76A2 [Vitis vinif... 65 1e-08 emb|CBI30230.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis]... 65 1e-08 ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis]... 65 1e-08 ref|XP_002277746.1| PREDICTED: cytochrome P450 76A2 [Vitis vinif... 65 1e-08 ref|XP_002277595.2| PREDICTED: cytochrome P450 76A2-like [Vitis ... 65 1e-08 ref|XP_002276576.1| PREDICTED: cytochrome P450 76C4 [Vitis vinif... 65 1e-08 sp|P37121.1|C76A1_SOLME RecName: Full=Cytochrome P450 76A1; AltN... 64 2e-08 >emb|CBI30232.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRKR 137 V FVL SLLH F+WEL ++PETIDMN+R+G TLRK PLKAIPRKR Sbjct: 378 VPFVLASLLHCFDWELGSNLTPETIDMNERVGLTLRKLVPLKAIPRKR 425 >ref|XP_002283772.1| PREDICTED: cytochrome P450 76A2 [Vitis vinifera] Length = 511 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRKR 137 V FVL SLLH F+WEL ++PETIDMN+R+G TLRK PLKAIPRKR Sbjct: 459 VPFVLASLLHCFDWELGSNLTPETIDMNERVGLTLRKLVPLKAIPRKR 506 >emb|CAN76784.1| hypothetical protein VITISV_028823 [Vitis vinifera] Length = 511 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRKR 137 V FVL SLLH F+WEL ++PETIDMN+R+G TLRK PLKAIPRKR Sbjct: 459 VPFVLASLLHCFDWELGSNLTPETIDMNERVGLTLRKLVPLKAIPRKR 506 >ref|XP_002528645.1| cytochrome P450, putative [Ricinus communis] gi|223531934|gb|EEF33748.1| cytochrome P450, putative [Ricinus communis] Length = 502 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/47 (59%), Positives = 38/47 (80%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRK 140 +H LGSLLH+F+WELE V+P+T+DM DR+G T+RK PL A+P+K Sbjct: 454 LHLTLGSLLHHFDWELEANVTPDTLDMRDRLGVTMRKLEPLLAVPKK 500 >ref|XP_004494132.1| PREDICTED: cytochrome P450 76A2-like [Cicer arietinum] Length = 511 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPR 143 +H VLGSLLH F+WEL+ V+P TIDM DR+G T+RK PL A+P+ Sbjct: 462 LHLVLGSLLHRFDWELDSNVTPSTIDMKDRLGITMRKFQPLLAVPK 507 >dbj|BAC53891.1| cytochrome P450 [Petunia x hybrida] Length = 507 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRK 140 VHFVLG+LLH F WEL H +S ++IDM +R+G T+RK PLK IP K Sbjct: 457 VHFVLGTLLHEFNWELPHNMSSKSIDMTERLGTTVRKLEPLKVIPNK 503 >ref|XP_003633930.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76C4-like [Vitis vinifera] Length = 493 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRK 140 VH +L SLLH F+W+LE G+ PE +DM ++ GFTLRKA PL+A+P K Sbjct: 446 VHLMLASLLHSFDWKLEDGMKPEDMDMTEKFGFTLRKAQPLQAVPIK 492 >ref|XP_002271323.1| PREDICTED: cytochrome P450 76C1-like [Vitis vinifera] Length = 471 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRK 140 VH +L SLLH F+W+LE G+ PE +DM ++ GFTLRKA PL+A+P K Sbjct: 424 VHLMLASLLHSFDWKLEDGLKPEDMDMTEKFGFTLRKAQPLQAVPIK 470 >emb|CAN81641.1| hypothetical protein VITISV_036425 [Vitis vinifera] Length = 473 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRK 140 VH +L SLLH F+W+LE G+ PE +DM ++ GFTLRKA PL+A+P K Sbjct: 426 VHLMLASLLHSFDWKLEDGLKPEDMDMTEKFGFTLRKAQPLQAVPIK 472 >ref|XP_002276053.1| PREDICTED: cytochrome P450 76C4-like [Vitis vinifera] Length = 496 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/47 (57%), Positives = 38/47 (80%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRK 140 VH +L SLLH + W+L+ G+ PE +DMN+++GFTL+KA PL+AIP K Sbjct: 449 VHLILASLLHSYAWKLDDGMKPEDMDMNEKLGFTLQKAQPLRAIPIK 495 >gb|EXC33898.1| Cytochrome P450 76A2 [Morus notabilis] Length = 509 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRK 140 +H VLGSLLH+F+WEL+ V ET+DM DR+G T+RK PL AIP K Sbjct: 461 LHLVLGSLLHHFDWELDASVDVETMDMKDRLGITVRKFEPLLAIPTK 507 >gb|EXC06132.1| Cytochrome P450 76C4 [Morus notabilis] Length = 645 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIP 146 +H +LGSLLH F+W+LE GVSPET++M D+ G TL+ A PL+A+P Sbjct: 598 LHLMLGSLLHSFDWKLEDGVSPETLNMEDKFGITLQMAQPLRALP 642 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -1 Query: 271 VLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPR 143 +LGSLLH F+W LE GV+PETI+M D+ G T + A PL+ IPR Sbjct: 99 MLGSLLHSFDWMLEDGVTPETINMEDKFGLTFQMAQPLRVIPR 141 >ref|XP_002283777.2| PREDICTED: cytochrome P450 76A2 [Vitis vinifera] Length = 512 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -1 Query: 268 LGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRKR 137 L SLLH F+WEL GV+PET+DMN+R+G T+RK PLK IP++R Sbjct: 467 LASLLHCFDWELGGGVTPETMDMNERVGITVRKLIPLKPIPKRR 510 >emb|CBI30230.3| unnamed protein product [Vitis vinifera] Length = 533 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -1 Query: 268 LGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRKR 137 L SLLH F+WEL GV+PET+DMN+R+G T+RK PLK IP++R Sbjct: 488 LASLLHCFDWELGGGVTPETMDMNERVGITVRKLIPLKPIPKRR 531 >ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis] gi|223531943|gb|EEF33757.1| cytochrome P450, putative [Ricinus communis] Length = 514 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRKR 137 +H L SLLH F+WEL +PETIDMN+R+G ++RK P+KAIP+K+ Sbjct: 464 LHLALASLLHCFDWELGSNSTPETIDMNERLGISVRKLVPMKAIPKKK 511 >ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis] gi|223531942|gb|EEF33756.1| cytochrome P450, putative [Ricinus communis] Length = 515 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRKR 137 +H L SLLH F+WEL +PE+IDMN+R+G T+RK P+KAIP+K+ Sbjct: 464 LHLALASLLHCFDWELGSNSTPESIDMNERLGITVRKLVPMKAIPKKK 511 >ref|XP_002277746.1| PREDICTED: cytochrome P450 76A2 [Vitis vinifera] Length = 509 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPR 143 +HFVLGSLLH+F+W+LE V+PET+DM +R G + K PLKA+P+ Sbjct: 458 LHFVLGSLLHHFDWQLERNVTPETMDMKERRGIVICKFHPLKAVPK 503 >ref|XP_002277595.2| PREDICTED: cytochrome P450 76A2-like [Vitis vinifera] Length = 332 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/47 (53%), Positives = 39/47 (82%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRK 140 +H VLG+LLH+F+W+L+ V+PET+DM ++ G +RK+ PLKA+P+K Sbjct: 284 LHLVLGTLLHHFDWQLKGNVTPETMDMKEKWGLVMRKSQPLKAVPKK 330 >ref|XP_002276576.1| PREDICTED: cytochrome P450 76C4 [Vitis vinifera] Length = 499 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRK 140 VH +L SLLH F+W+LE + PE +DM+++ GFTLRKA PL+A+P K Sbjct: 452 VHLMLASLLHSFDWKLEDSMRPEDMDMSEKFGFTLRKAQPLRAVPTK 498 >sp|P37121.1|C76A1_SOLME RecName: Full=Cytochrome P450 76A1; AltName: Full=CYPLXXVIA1; AltName: Full=Cytochrome P-450EG8 gi|1345576|emb|CAA50649.1| unnamed protein product [Solanum melongena] Length = 467 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = -1 Query: 280 VHFVLGSLLHYFEWELEHGVSPETIDMNDRIGFTLRKATPLKAIPRK 140 +HF GSLLH F+WEL H VSP++I+M + +G T RK PLK IP+K Sbjct: 420 MHFTFGSLLHEFDWELPHNVSPKSINMEESMGITARKKQPLKVIPKK 466