BLASTX nr result
ID: Akebia25_contig00035106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00035106 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006347119.1| PREDICTED: putative ribonuclease H protein A... 56 6e-06 ref|XP_006337991.1| PREDICTED: putative ribonuclease H protein A... 56 6e-06 >ref|XP_006347119.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum tuberosum] Length = 450 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/57 (38%), Positives = 38/57 (66%) Frame = +3 Query: 15 SWDLSMFVGRRKILWRLLPSAITWGLWLERNKRIFKGLETSI*DLILNILGLMFFSC 185 SW+ + + + + WR++P++I W +W ERN R F+G+E S+ D+ LN + L+ F C Sbjct: 376 SWEEAGALAKDRTRWRIIPASIWWAIWKERNSRCFEGIENSVQDVKLNCILLLCFWC 432 >ref|XP_006337991.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum tuberosum] Length = 556 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/57 (38%), Positives = 38/57 (66%) Frame = +3 Query: 15 SWDLSMFVGRRKILWRLLPSAITWGLWLERNKRIFKGLETSI*DLILNILGLMFFSC 185 SW+ + + + + WR++P++I W +W ERN R F+G+E S+ D+ LN + L+ F C Sbjct: 482 SWEEAGALAKDRTRWRIIPASIWWAIWKERNSRCFEGIENSVQDVKLNCILLLCFWC 538