BLASTX nr result
ID: Akebia25_contig00035048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00035048 (587 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON67132.1| hypothetical protein W97_06385 [Coniosporium apol... 140 3e-31 ref|XP_007584660.1| putative ribonuclease p complex subunit prot... 138 1e-30 gb|EKG18491.1| hypothetical protein MPH_04293 [Macrophomina phas... 135 8e-30 gb|EOA91224.1| hypothetical protein SETTUDRAFT_17919 [Setosphaer... 132 7e-29 gb|EMC98931.1| hypothetical protein BAUCODRAFT_31207 [Baudoinia ... 131 2e-28 ref|XP_003305078.1| hypothetical protein PTT_17825 [Pyrenophora ... 129 5e-28 ref|XP_001935093.1| conserved hypothetical protein [Pyrenophora ... 129 5e-28 ref|XP_003853515.1| hypothetical protein MYCGRDRAFT_104074 [Zymo... 129 8e-28 gb|EMF14605.1| hypothetical protein SEPMUDRAFT_140339 [Sphaeruli... 128 1e-27 ref|XP_001801776.1| hypothetical protein SNOG_11536 [Phaeosphaer... 126 4e-27 gb|EME82569.1| hypothetical protein MYCFIDRAFT_103441, partial [... 124 2e-26 gb|EME45952.1| hypothetical protein DOTSEDRAFT_147773 [Dothistro... 122 7e-26 gb|EUN24083.1| hypothetical protein COCVIDRAFT_18457 [Bipolaris ... 115 9e-24 gb|EUC30699.1| hypothetical protein COCCADRAFT_39084 [Bipolaris ... 115 1e-23 ref|XP_003841042.1| predicted protein [Leptosphaeria maculans JN... 115 1e-23 gb|EUC45806.1| hypothetical protein COCMIDRAFT_47977, partial [B... 114 3e-23 gb|EMD59528.1| hypothetical protein COCSADRAFT_126791 [Bipolaris... 113 4e-23 gb|EMD85540.1| hypothetical protein COCHEDRAFT_1188001 [Bipolari... 111 1e-22 gb|EFW15461.1| hypothetical protein CPSG_07898 [Coccidioides pos... 103 5e-20 gb|EGE09498.1| hypothetical protein TEQG_08447 [Trichophyton equ... 101 2e-19 >gb|EON67132.1| hypothetical protein W97_06385 [Coniosporium apollinis CBS 100218] Length = 114 Score = 140 bits (353), Expect = 3e-31 Identities = 57/65 (87%), Positives = 63/65 (96%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S+LKGYENVTVQCQNCGN SG VYKRWEWFTFCFIP+VPFSLKPW+E+GC++CNFYQDIK Sbjct: 14 SRLKGYENVTVQCQNCGNFSGHVYKRWEWFTFCFIPIVPFSLKPWQEIGCNVCNFYQDIK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >ref|XP_007584660.1| putative ribonuclease p complex subunit protein [Neofusicoccum parvum UCRNP2] gi|485922353|gb|EOD47875.1| putative ribonuclease p complex subunit protein [Neofusicoccum parvum UCRNP2] Length = 117 Score = 138 bits (347), Expect = 1e-30 Identities = 54/65 (83%), Positives = 61/65 (93%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S+LKGYENVT QCQNCGN SG VYKRW+WFTFCF+P++PFS+KPW E+GCHICNFYQDIK Sbjct: 14 SRLKGYENVTCQCQNCGNFSGHVYKRWQWFTFCFVPIIPFSIKPWHEIGCHICNFYQDIK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >gb|EKG18491.1| hypothetical protein MPH_04293 [Macrophomina phaseolina MS6] Length = 107 Score = 135 bits (340), Expect = 8e-30 Identities = 54/65 (83%), Positives = 60/65 (92%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S+LKGYE VT QCQNCGN SG V+KRW+WFTFCF+P++PFSLKPW EVGCHICNFYQDIK Sbjct: 14 SRLKGYEQVTCQCQNCGNFSGHVFKRWQWFTFCFVPIIPFSLKPWHEVGCHICNFYQDIK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >gb|EOA91224.1| hypothetical protein SETTUDRAFT_17919 [Setosphaeria turcica Et28A] Length = 121 Score = 132 bits (332), Expect = 7e-29 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S LKG EN+TVQCQNCGN SGRV KRWEWFTFCFIP++PFS+KP+KEVGCHICNF+QDIK Sbjct: 14 SPLKGAENITVQCQNCGNFSGRVMKRWEWFTFCFIPVIPFSVKPYKEVGCHICNFWQDIK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >gb|EMC98931.1| hypothetical protein BAUCODRAFT_31207 [Baudoinia compniacensis UAMH 10762] Length = 115 Score = 131 bits (329), Expect = 2e-28 Identities = 54/65 (83%), Positives = 59/65 (90%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S L+GYENVTVQCQNCGN SGRV KRWEWFT CF+PL+PFSLKPW EV CHICNF+QD+K Sbjct: 14 SLLQGYENVTVQCQNCGNFSGRVVKRWEWFTLCFVPLIPFSLKPWHEVFCHICNFHQDVK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >ref|XP_003305078.1| hypothetical protein PTT_17825 [Pyrenophora teres f. teres 0-1] gi|311318024|gb|EFQ86791.1| hypothetical protein PTT_17825 [Pyrenophora teres f. teres 0-1] Length = 122 Score = 129 bits (325), Expect = 5e-28 Identities = 53/65 (81%), Positives = 61/65 (93%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S+L G E++TVQCQNCGN SGRV KRWEWFTFCFIP++PFS+KP+KEVGCHICNF+QDIK Sbjct: 14 SKLSGAEHITVQCQNCGNFSGRVMKRWEWFTFCFIPVIPFSIKPYKEVGCHICNFWQDIK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >ref|XP_001935093.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187981041|gb|EDU47667.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 123 Score = 129 bits (325), Expect = 5e-28 Identities = 53/65 (81%), Positives = 61/65 (93%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S+L G E++TVQCQNCGN SGRV KRWEWFTFCFIP++PFS+KP+KEVGCHICNF+QDIK Sbjct: 14 SKLSGAEHITVQCQNCGNFSGRVMKRWEWFTFCFIPVIPFSIKPYKEVGCHICNFWQDIK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >ref|XP_003853515.1| hypothetical protein MYCGRDRAFT_104074 [Zymoseptoria tritici IPO323] gi|339473397|gb|EGP88491.1| hypothetical protein MYCGRDRAFT_104074 [Zymoseptoria tritici IPO323] Length = 133 Score = 129 bits (323), Expect = 8e-28 Identities = 53/65 (81%), Positives = 58/65 (89%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S L GYEN+TVQCQNCGN SG+V KRWEWFTFCF+PL+PFSLKPW VGCHIC+F QDIK Sbjct: 14 SLLAGYENITVQCQNCGNWSGKVVKRWEWFTFCFVPLIPFSLKPWHAVGCHICHFKQDIK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >gb|EMF14605.1| hypothetical protein SEPMUDRAFT_140339 [Sphaerulina musiva SO2202] Length = 147 Score = 128 bits (321), Expect = 1e-27 Identities = 52/65 (80%), Positives = 57/65 (87%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S LKGYEN+TVQCQNCGN SG+V KRWEWFTFCF+P++PFSLKPW V CHIC F QDIK Sbjct: 14 SLLKGYENITVQCQNCGNFSGKVVKRWEWFTFCFVPIIPFSLKPWHAVNCHICQFKQDIK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >ref|XP_001801776.1| hypothetical protein SNOG_11536 [Phaeosphaeria nodorum SN15] gi|111060124|gb|EAT81244.1| hypothetical protein SNOG_11536 [Phaeosphaeria nodorum SN15] Length = 115 Score = 126 bits (317), Expect = 4e-27 Identities = 52/65 (80%), Positives = 60/65 (92%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S L G E++TVQCQNCGN+SGRV KRWEWFTFCF+P++PFSLKP+KEVGCHIC+F QDIK Sbjct: 14 SALSGAEHITVQCQNCGNLSGRVMKRWEWFTFCFVPIIPFSLKPYKEVGCHICHFGQDIK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >gb|EME82569.1| hypothetical protein MYCFIDRAFT_103441, partial [Pseudocercospora fijiensis CIRAD86] Length = 100 Score = 124 bits (310), Expect = 2e-26 Identities = 50/65 (76%), Positives = 57/65 (87%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S L GYEN+TVQCQNCGN SG+V KRWEWFTFCF+P++PFSLKPW V CHIC+F QD+K Sbjct: 14 SLLAGYENITVQCQNCGNWSGKVSKRWEWFTFCFVPIIPFSLKPWHCVNCHICHFQQDLK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >gb|EME45952.1| hypothetical protein DOTSEDRAFT_147773 [Dothistroma septosporum NZE10] Length = 117 Score = 122 bits (306), Expect = 7e-26 Identities = 48/65 (73%), Positives = 58/65 (89%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S L GYEN+TVQCQNCGN SG++ KRWEWFTFCF+P++PFSLKP+ +V CHIC F+QDIK Sbjct: 14 SLLAGYENITVQCQNCGNFSGKITKRWEWFTFCFVPIIPFSLKPYHDVSCHICRFHQDIK 73 Query: 283 YRPDV 297 +RPDV Sbjct: 74 HRPDV 78 >gb|EUN24083.1| hypothetical protein COCVIDRAFT_18457 [Bipolaris victoriae FI3] Length = 114 Score = 115 bits (288), Expect = 9e-24 Identities = 49/65 (75%), Positives = 54/65 (83%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S LKG E+V VQCQNCGN V KRWEWFTFCFIP++PFSLKP+KEVGC C F+QDIK Sbjct: 14 SPLKGAESVRVQCQNCGNFETAVMKRWEWFTFCFIPVIPFSLKPYKEVGCRTCRFWQDIK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >gb|EUC30699.1| hypothetical protein COCCADRAFT_39084 [Bipolaris zeicola 26-R-13] Length = 116 Score = 115 bits (287), Expect = 1e-23 Identities = 49/65 (75%), Positives = 54/65 (83%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S LKG E + VQCQNCGN V KRWEWFTFCFIP++PFSLKP+KEVGC CNF+QDIK Sbjct: 14 SPLKGAEGIQVQCQNCGNGRTAVMKRWEWFTFCFIPVIPFSLKPYKEVGCSTCNFWQDIK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >ref|XP_003841042.1| predicted protein [Leptosphaeria maculans JN3] gi|312217616|emb|CBX97563.1| predicted protein [Leptosphaeria maculans JN3] Length = 114 Score = 115 bits (287), Expect = 1e-23 Identities = 46/65 (70%), Positives = 55/65 (84%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S L ++T QCQNCGN S RV KRWEWFTFCFIP++PFSLKP++EVGC +CNF+QD+K Sbjct: 14 SPLPNASHITTQCQNCGNYSARVMKRWEWFTFCFIPVIPFSLKPYREVGCPVCNFWQDVK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >gb|EUC45806.1| hypothetical protein COCMIDRAFT_47977, partial [Bipolaris oryzae ATCC 44560] Length = 85 Score = 114 bits (284), Expect = 3e-23 Identities = 48/65 (73%), Positives = 55/65 (84%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 SQLKG E+V VQCQNCGN V KRWEWFTFCFIP++PFSLKP+KE+GC C+F+QDI Sbjct: 14 SQLKGAEHVQVQCQNCGNYRTAVMKRWEWFTFCFIPVIPFSLKPYKELGCSTCHFWQDIN 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >gb|EMD59528.1| hypothetical protein COCSADRAFT_126791 [Bipolaris sorokiniana ND90Pr] Length = 117 Score = 113 bits (282), Expect = 4e-23 Identities = 47/65 (72%), Positives = 55/65 (84%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S+LKG ++ VQCQNCGN V KRWEWFTFCFIP++PFSLKP+KEVGC C+F+QDIK Sbjct: 14 SELKGAGHIKVQCQNCGNFRTGVMKRWEWFTFCFIPVIPFSLKPYKEVGCETCHFWQDIK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >gb|EMD85540.1| hypothetical protein COCHEDRAFT_1188001 [Bipolaris maydis C5] gi|477582903|gb|ENI00007.1| hypothetical protein COCC4DRAFT_65910 [Bipolaris maydis ATCC 48331] Length = 117 Score = 111 bits (278), Expect = 1e-22 Identities = 50/66 (75%), Positives = 55/66 (83%), Gaps = 1/66 (1%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGN-MSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDI 279 S LKG ENV QCQNCGN V KRWEWFTFCFIP++PFSLKP+KEVGC IC+F+QDI Sbjct: 14 SPLKGAENVIAQCQNCGNGHRTAVMKRWEWFTFCFIPVIPFSLKPYKEVGCGICHFWQDI 73 Query: 280 KYRPDV 297 KYRPDV Sbjct: 74 KYRPDV 79 >gb|EFW15461.1| hypothetical protein CPSG_07898 [Coccidioides posadasii str. Silveira] gi|392868366|gb|EAS34144.2| hypothetical protein CIMG_11431 [Coccidioides immitis RS] Length = 112 Score = 103 bits (256), Expect = 5e-20 Identities = 41/65 (63%), Positives = 50/65 (76%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 S+L+GYEN+T QCQNCGN S + RW WFT CF+P++P + +KEV CHIC F QDIK Sbjct: 14 SRLQGYENITAQCQNCGNWSAQCITRWPWFTVCFVPVIPLAFHKYKEVYCHICRFTQDIK 73 Query: 283 YRPDV 297 YRPDV Sbjct: 74 YRPDV 78 >gb|EGE09498.1| hypothetical protein TEQG_08447 [Trichophyton equinum CBS 127.97] gi|607889592|gb|EZF29921.1| hypothetical protein H101_06433 [Trichophyton interdigitale H6] Length = 122 Score = 101 bits (251), Expect = 2e-19 Identities = 43/65 (66%), Positives = 50/65 (76%) Frame = +1 Query: 103 SQLKGYENVTVQCQNCGNMSGRVYKRWEWFTFCFIPLVPFSLKPWKEVGCHICNFYQDIK 282 SQL+GYENVT QCQNCGN SGR RW +FT CFIPL+P ++ +KEV CHIC F QD+ Sbjct: 14 SQLQGYENVTAQCQNCGNWSGRCITRWPFFTVCFIPLIPLAMHKYKEVYCHICRFSQDMS 73 Query: 283 YRPDV 297 RPDV Sbjct: 74 MRPDV 78