BLASTX nr result
ID: Akebia25_contig00034979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00034979 (882 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513096.1| conserved hypothetical protein [Ricinus comm... 97 4e-22 ref|XP_004987296.1| PREDICTED: uncharacterized protein LOC101768... 89 2e-15 ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago ... 88 4e-15 ref|XP_002535310.1| conserved hypothetical protein [Ricinus comm... 73 1e-10 ref|XP_002529560.1| conserved hypothetical protein [Ricinus comm... 63 2e-07 gb|ABE98701.1| hypothetical protein (mitochondrion) [Zea mays su... 57 7e-06 gb|ABE98744.1| hypothetical protein (mitochondrion) [Zea mays su... 57 7e-06 ref|YP_588287.1| hypothetical protein ZeamMp023 [Zea mays subsp.... 57 7e-06 >ref|XP_002513096.1| conserved hypothetical protein [Ricinus communis] gi|223548107|gb|EEF49599.1| conserved hypothetical protein [Ricinus communis] Length = 813 Score = 97.4 bits (241), Expect(2) = 4e-22 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = +1 Query: 652 HRGVVARVSRPGILHLAFMISTFNCAPETRSKHARPVCFFHDMLWS 789 H GVVARVSRPGILHLAFMISTF CAPETRSKHARPVCFFHDMLWS Sbjct: 753 HMGVVARVSRPGILHLAFMISTFRCAPETRSKHARPVCFFHDMLWS 798 Score = 34.7 bits (78), Expect(2) = 4e-22 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +2 Query: 617 GRRGPGCASDRHIG 658 GRRGPGCASDRH+G Sbjct: 742 GRRGPGCASDRHMG 755 >ref|XP_004987296.1| PREDICTED: uncharacterized protein LOC101768809 [Setaria italica] Length = 71 Score = 89.4 bits (220), Expect = 2e-15 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = +1 Query: 706 MISTFNCAPETRSKHARPVCFFHDMLWSRVSSCGLLALEEVV 831 MISTFNCAPETRSKHARPVC FHDMLWSRVSSCGLLALEEVV Sbjct: 1 MISTFNCAPETRSKHARPVCVFHDMLWSRVSSCGLLALEEVV 42 >ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago truncatula] gi|355477353|gb|AES58556.1| hypothetical protein MTR_1g005670 [Medicago truncatula] Length = 250 Score = 88.2 bits (217), Expect = 4e-15 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = +1 Query: 706 MISTFNCAPETRSKHARPVCFFHDMLWSRVSSCGLLALEEVV 831 MISTFNCAPETRSKHARPVCFFHDMLWSRVSS GLLALEEVV Sbjct: 1 MISTFNCAPETRSKHARPVCFFHDMLWSRVSSSGLLALEEVV 42 >ref|XP_002535310.1| conserved hypothetical protein [Ricinus communis] gi|255590896|ref|XP_002535392.1| conserved hypothetical protein [Ricinus communis] gi|223523262|gb|EEF26991.1| conserved hypothetical protein [Ricinus communis] gi|223523475|gb|EEF27071.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 73.2 bits (178), Expect = 1e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 835 KARLLLTLEDHRKTPGTRACRERSTLGGRASTVSPGHS 722 + RLLLTLEDHR PGTRACRERSTLGGRASTVSPGHS Sbjct: 57 RTRLLLTLEDHRNIPGTRACRERSTLGGRASTVSPGHS 94 >ref|XP_002529560.1| conserved hypothetical protein [Ricinus communis] gi|223530972|gb|EEF32829.1| conserved hypothetical protein [Ricinus communis] Length = 93 Score = 62.8 bits (151), Expect = 2e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 814 LEDHRKTPGTRACRERSTLGGRASTVSPGHS 722 +EDHR PGTRACRERSTLGGRASTVSPGHS Sbjct: 63 VEDHRNIPGTRACRERSTLGGRASTVSPGHS 93 >gb|ABE98701.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] gi|102579661|gb|ABF70941.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] Length = 163 Score = 57.4 bits (137), Expect = 7e-06 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 835 KARLLLTLEDHRKTPGTRACRERSTLGGRASTVSP 731 + RLLLTLEDHRK PGTRACRER T GGRAS P Sbjct: 58 RTRLLLTLEDHRKKPGTRACRERRTRGGRASDQCP 92 >gb|ABE98744.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] gi|93116158|gb|ABE98789.1| hypothetical protein [Zea mays subsp. mays] gi|413954480|gb|AFW87129.1| putative uncharacterized protein orf127 [Zea mays] Length = 159 Score = 57.4 bits (137), Expect = 7e-06 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 835 KARLLLTLEDHRKTPGTRACRERSTLGGRASTVSP 731 + RLLLTLEDHRK PGTRACRER T GGRAS P Sbjct: 58 RTRLLLTLEDHRKKPGTRACRERRTRGGRASDQCP 92 >ref|YP_588287.1| hypothetical protein ZeamMp023 [Zea mays subsp. mays] gi|40795066|gb|AAR91110.1| hypothetical protein (mitochondrion) [Zea mays] Length = 127 Score = 57.4 bits (137), Expect = 7e-06 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 835 KARLLLTLEDHRKTPGTRACRERSTLGGRASTVSP 731 + RLLLTLEDHRK PGTRACRER T GGRAS P Sbjct: 26 RTRLLLTLEDHRKKPGTRACRERRTRGGRASDQCP 60