BLASTX nr result
ID: Akebia25_contig00034962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00034962 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007584406.1| putative 60s ribosomal protein l29 protein [... 105 5e-21 gb|EKG10723.1| Ribosomal protein L29e [Macrophomina phaseolina MS6] 103 2e-20 ref|XP_001245359.1| 60S ribosomal protein L29 [Coccidioides immi... 103 2e-20 gb|ETS83397.1| 60S ribosomal protein L29 [Pestalotiopsis fici W1... 103 2e-20 emb|CCU75680.1| 60S ribosomal protein L29 [Blumeria graminis f. ... 103 2e-20 gb|EPQ63736.1| Protein component of the large (60S) ribosomal su... 103 2e-20 gb|EME39946.1| hypothetical protein DOTSEDRAFT_47443 [Dothistrom... 103 2e-20 ref|XP_001591553.1| 60S ribosomal protein L29 [Sclerotinia scler... 103 2e-20 ref|XP_001550019.1| 60S ribosomal protein L29 [Botryotinia fucke... 103 2e-20 gb|ETR96974.1| ribosomal L29e family protein [Trichoderma reesei... 102 6e-20 gb|EQB58737.1| hypothetical protein CGLO_00978 [Colletotrichum g... 102 6e-20 gb|ENH83968.1| 60s ribosomal protein, partial [Colletotrichum or... 102 6e-20 ref|XP_006969770.1| ribosomal protein L29 [Trichoderma reesei QM... 102 6e-20 gb|EGE05211.1| 60S ribosomal protein L29 [Trichophyton equinum C... 102 6e-20 ref|XP_003233161.1| 60S ribosomal protein L29 [Trichophyton rubr... 102 6e-20 ref|XP_007590915.1| 60S ribosomal protein L29 [Colletotrichum fi... 102 6e-20 ref|XP_002846081.1| 60S ribosomal protein L29 [Arthroderma otae ... 102 6e-20 ref|XP_002484361.1| 60S ribosomal protein L29 [Talaromyces stipi... 102 6e-20 ref|XP_002149901.1| 60S ribosomal protein L29 [Talaromyces marne... 102 6e-20 ref|XP_003848719.1| 60S ribosomal protein L29 [Zymoseptoria trit... 102 7e-20 >ref|XP_007584406.1| putative 60s ribosomal protein l29 protein [Neofusicoccum parvum UCRNP2] gi|485922783|gb|EOD48111.1| putative 60s ribosomal protein l29 protein [Neofusicoccum parvum UCRNP2] Length = 88 Score = 105 bits (263), Expect = 5e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTM+AL Sbjct: 6 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMRAL 54 >gb|EKG10723.1| Ribosomal protein L29e [Macrophomina phaseolina MS6] Length = 70 Score = 103 bits (258), Expect = 2e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQSKKAHRNGIKKPKT+RYPSLKGVDPKFRRNHRHALHGTM+AL Sbjct: 6 NSSQHNQSKKAHRNGIKKPKTHRYPSLKGVDPKFRRNHRHALHGTMRAL 54 >ref|XP_001245359.1| 60S ribosomal protein L29 [Coccidioides immitis RS] gi|258566009|ref|XP_002583749.1| predicted protein [Uncinocarpus reesii 1704] gi|303323027|ref|XP_003071505.1| 60S ribosomal protein L29 [Coccidioides posadasii C735 delta SOWgp] gi|237907450|gb|EEP81851.1| predicted protein [Uncinocarpus reesii 1704] gi|240111207|gb|EER29360.1| 60S ribosomal protein L29, putative [Coccidioides posadasii C735 delta SOWgp] gi|320033315|gb|EFW15263.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] gi|392868264|gb|EAS34023.2| 60S ribosomal protein L29 [Coccidioides immitis RS] Length = 65 Score = 103 bits (258), Expect = 2e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQ+KKAHRNGIKKPKT+RYPSLKGVDPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQNKKAHRNGIKKPKTHRYPSLKGVDPKFRRNHRHALHGTMKAL 54 >gb|ETS83397.1| 60S ribosomal protein L29 [Pestalotiopsis fici W106-1] Length = 65 Score = 103 bits (257), Expect = 2e-20 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQSKKAHRNGIKKPKT+RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQSKKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKAL 54 >emb|CCU75680.1| 60S ribosomal protein L29 [Blumeria graminis f. sp. hordei DH14] Length = 65 Score = 103 bits (257), Expect = 2e-20 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQSKKAHRNGIKKPKT+RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQSKKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKAL 54 >gb|EPQ63736.1| Protein component of the large (60S) ribosomal subunit, partial [Blumeria graminis f. sp. tritici 96224] Length = 63 Score = 103 bits (257), Expect = 2e-20 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQSKKAHRNGIKKPKT+RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 4 NSSQHNQSKKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKAL 52 >gb|EME39946.1| hypothetical protein DOTSEDRAFT_47443 [Dothistroma septosporum NZE10] Length = 65 Score = 103 bits (257), Expect = 2e-20 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQSKKAHRNGIKKPKT+RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQSKKAHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKAL 54 >ref|XP_001591553.1| 60S ribosomal protein L29 [Sclerotinia sclerotiorum 1980 UF-70] gi|154704777|gb|EDO04516.1| predicted protein [Sclerotinia sclerotiorum 1980 UF-70] Length = 65 Score = 103 bits (257), Expect = 2e-20 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQSKKAHRNGIKKPKT+RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQSKKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKAL 54 >ref|XP_001550019.1| 60S ribosomal protein L29 [Botryotinia fuckeliana B05.10] gi|347835053|emb|CCD49625.1| similar to 60S ribosomal protein L29 [Botryotinia fuckeliana T4] Length = 65 Score = 103 bits (257), Expect = 2e-20 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQSKKAHRNGIKKPKT+RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQSKKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKAL 54 >gb|ETR96974.1| ribosomal L29e family protein [Trichoderma reesei RUT C-30] Length = 63 Score = 102 bits (254), Expect = 6e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQS+KAHRNGIKKPKT+RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQSRKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKAL 54 >gb|EQB58737.1| hypothetical protein CGLO_00978 [Colletotrichum gloeosporioides Cg-14] Length = 393 Score = 102 bits (254), Expect = 6e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQS+KAHRNGIKKPKT+RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 334 NSSQHNQSRKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKAL 382 >gb|ENH83968.1| 60s ribosomal protein, partial [Colletotrichum orbiculare MAFF 240422] Length = 54 Score = 102 bits (254), Expect = 6e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQS+KAHRNGIKKPKT+RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQSRKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKAL 54 >ref|XP_006969770.1| ribosomal protein L29 [Trichoderma reesei QM6a] gi|340514000|gb|EGR44271.1| ribosomal protein L29 [Trichoderma reesei QM6a] Length = 59 Score = 102 bits (254), Expect = 6e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQS+KAHRNGIKKPKT+RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQSRKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKAL 54 >gb|EGE05211.1| 60S ribosomal protein L29 [Trichophyton equinum CBS 127.97] Length = 67 Score = 102 bits (254), Expect = 6e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQ+KKAHRNGIKKPKT+RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQNKKAHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKAL 54 >ref|XP_003233161.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 118892] gi|326464467|gb|EGD89920.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 118892] gi|607880408|gb|EZF25263.1| 60S ribosomal protein L29 [Trichophyton rubrum MR850] gi|607907085|gb|EZF44258.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 100081] gi|607919218|gb|EZF54948.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 288.86] gi|607931271|gb|EZF65566.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 289.86] gi|607955288|gb|EZF86859.1| 60S ribosomal protein L29 [Trichophyton rubrum MR1448] gi|607967496|gb|EZF97649.1| 60S ribosomal protein L29 [Trichophyton rubrum MR1459] gi|607991495|gb|EZG19185.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 202.88] Length = 65 Score = 102 bits (254), Expect = 6e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQ+KKAHRNGIKKPKT+RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQNKKAHRNGIKKPKTDRYPSLKGTDPKFRRNHRHALHGTMKAL 54 >ref|XP_007590915.1| 60S ribosomal protein L29 [Colletotrichum fioriniae PJ7] gi|310798355|gb|EFQ33248.1| ribosomal L29e family protein [Colletotrichum graminicola M1.001] gi|358380121|gb|EHK17800.1| hypothetical protein TRIVIDRAFT_88807 [Trichoderma virens Gv29-8] gi|380475206|emb|CCF45371.1| 60S ribosomal protein L29 [Colletotrichum higginsianum] gi|588905742|gb|EXF85442.1| 60S ribosomal protein L29 [Colletotrichum fioriniae PJ7] Length = 65 Score = 102 bits (254), Expect = 6e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQS+KAHRNGIKKPKT+RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQSRKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKAL 54 >ref|XP_002846081.1| 60S ribosomal protein L29 [Arthroderma otae CBS 113480] gi|238843469|gb|EEQ33131.1| conserved hypothetical protein [Arthroderma otae CBS 113480] gi|326476329|gb|EGE00339.1| 60S ribosomal protein L29 [Trichophyton tonsurans CBS 112818] gi|607892685|gb|EZF32010.1| 60S ribosomal protein L29 [Trichophyton interdigitale H6] gi|607943201|gb|EZF76196.1| 60S ribosomal protein L29 [Trichophyton soudanense CBS 452.61] gi|607979708|gb|EZG08705.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 735.88] Length = 65 Score = 102 bits (254), Expect = 6e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQ+KKAHRNGIKKPKT+RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQNKKAHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKAL 54 >ref|XP_002484361.1| 60S ribosomal protein L29 [Talaromyces stipitatus ATCC 10500] gi|218717706|gb|EED17127.1| 60S ribosomal protein L29, putative [Talaromyces stipitatus ATCC 10500] Length = 65 Score = 102 bits (254), Expect = 6e-20 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQSKKAHRNGIKKPKT RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQSKKAHRNGIKKPKTYRYPSLKGTDPKFRRNHRHALHGTMKAL 54 >ref|XP_002149901.1| 60S ribosomal protein L29 [Talaromyces marneffei ATCC 18224] gi|210067200|gb|EEA21292.1| 60S ribosomal protein L29, putative [Talaromyces marneffei ATCC 18224] Length = 65 Score = 102 bits (254), Expect = 6e-20 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQSKKAHRNGIKKPKT RYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQSKKAHRNGIKKPKTYRYPSLKGTDPKFRRNHRHALHGTMKAL 54 >ref|XP_003848719.1| 60S ribosomal protein L29 [Zymoseptoria tritici IPO323] gi|339468594|gb|EGP83695.1| hypothetical protein MYCGRDRAFT_82510 [Zymoseptoria tritici IPO323] Length = 65 Score = 102 bits (253), Expect = 7e-20 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = +2 Query: 2 NSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMKAL 148 NSSQHNQSKK H+NGIKKPKTNRYPSLKG DPKFRRNHRHALHGTMKAL Sbjct: 6 NSSQHNQSKKNHKNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMKAL 54