BLASTX nr result
ID: Akebia25_contig00034961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00034961 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXJ74341.1| 60S ribosomal protein L29 [Cladophialophora psamm... 103 3e-20 gb|EXJ88245.1| large subunit ribosomal protein L29e [Capronia co... 102 4e-20 gb|ETI26334.1| 60S ribosomal protein L29 [Cladophialophora carri... 102 4e-20 gb|EME77731.1| hypothetical protein MYCFIDRAFT_65593 [Pseudocerc... 102 4e-20 gb|ETN36867.1| 60S ribosomal protein L29 [Cyphellophora europaea... 102 7e-20 gb|EME39946.1| hypothetical protein DOTSEDRAFT_47443 [Dothistrom... 101 9e-20 gb|EMC99978.1| hypothetical protein BAUCODRAFT_119538 [Baudoinia... 101 9e-20 gb|EMF08841.1| hypothetical protein SEPMUDRAFT_151754 [Sphaeruli... 100 2e-19 ref|XP_003848719.1| 60S ribosomal protein L29 [Zymoseptoria trit... 100 2e-19 ref|XP_003171468.1| 60S ribosomal protein L29 [Arthroderma gypse... 100 2e-19 ref|XP_002846081.1| 60S ribosomal protein L29 [Arthroderma otae ... 100 2e-19 emb|CCX09672.1| Similar to 60S ribosomal protein L29; acc. no. P... 100 3e-19 gb|EON68946.1| 60S ribosomal protein L29 [Coniosporium apollinis... 100 3e-19 ref|XP_003233161.1| 60S ribosomal protein L29 [Trichophyton rubr... 100 4e-19 ref|XP_002792319.1| 60S ribosomal protein L29 [Paracoccidioides ... 99 6e-19 gb|EEH11222.1| conserved hypothetical protein [Ajellomyces capsu... 99 6e-19 ref|XP_001936717.1| conserved hypothetical protein [Pyrenophora ... 99 6e-19 ref|XP_001805871.1| hypothetical protein SNOG_15733 [Phaeosphaer... 99 6e-19 ref|XP_001540942.1| predicted protein [Ajellomyces capsulatus NA... 99 6e-19 gb|EXJ87049.1| large subunit ribosomal protein L29e [Capronia ep... 98 1e-18 >gb|EXJ74341.1| 60S ribosomal protein L29 [Cladophialophora psammophila CBS 110553] Length = 65 Score = 103 bits (256), Expect = 3e-20 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +2 Query: 77 AHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 AHKNGIKKPKTFRYPSLKGTDPKFRRNH+HALHGTMKALKEV+EG RDAA Sbjct: 16 AHKNGIKKPKTFRYPSLKGTDPKFRRNHKHALHGTMKALKEVREGKRDAA 65 >gb|EXJ88245.1| large subunit ribosomal protein L29e [Capronia coronata CBS 617.96] Length = 121 Score = 102 bits (255), Expect = 4e-20 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = +2 Query: 77 AHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 AHKNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTMKALKEVKEG RDAA Sbjct: 72 AHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 121 >gb|ETI26334.1| 60S ribosomal protein L29 [Cladophialophora carrionii CBS 160.54] gi|589973335|gb|EXJ56653.1| 60S ribosomal protein L29 [Cladophialophora yegresii CBS 114405] Length = 65 Score = 102 bits (255), Expect = 4e-20 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = +2 Query: 77 AHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 AHKNGIKKPKTFRYPSLKGTDPKFRRNH+HALHGTMKALKEVKEG RD A Sbjct: 16 AHKNGIKKPKTFRYPSLKGTDPKFRRNHKHALHGTMKALKEVKEGKRDTA 65 >gb|EME77731.1| hypothetical protein MYCFIDRAFT_65593 [Pseudocercospora fijiensis CIRAD86] Length = 65 Score = 102 bits (255), Expect = 4e-20 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = +2 Query: 77 AHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 AHKNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTMKALKEVKEG RDAA Sbjct: 16 AHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 65 >gb|ETN36867.1| 60S ribosomal protein L29 [Cyphellophora europaea CBS 101466] Length = 91 Score = 102 bits (253), Expect = 7e-20 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +2 Query: 77 AHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 AH+NGIKKPKTFRYPSLKGTDPKFRRNH+HALHGTM+ALKEVKEG RDAA Sbjct: 42 AHRNGIKKPKTFRYPSLKGTDPKFRRNHKHALHGTMRALKEVKEGKRDAA 91 >gb|EME39946.1| hypothetical protein DOTSEDRAFT_47443 [Dothistroma septosporum NZE10] Length = 65 Score = 101 bits (252), Expect = 9e-20 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = +2 Query: 77 AHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 AH+NGIKKPKT RYPSLKGTDPKFRRNHRHALHGTMKALKEVKEG RDAA Sbjct: 16 AHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 65 >gb|EMC99978.1| hypothetical protein BAUCODRAFT_119538 [Baudoinia compniacensis UAMH 10762] Length = 65 Score = 101 bits (252), Expect = 9e-20 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = +2 Query: 77 AHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 AHKNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM+ALKEVKEG RDAA Sbjct: 16 AHKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRDAA 65 >gb|EMF08841.1| hypothetical protein SEPMUDRAFT_151754 [Sphaerulina musiva SO2202] Length = 65 Score = 100 bits (249), Expect = 2e-19 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = +2 Query: 80 HKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 HKNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTMKALKEVKEG RDAA Sbjct: 17 HKNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 65 >ref|XP_003848719.1| 60S ribosomal protein L29 [Zymoseptoria tritici IPO323] gi|339468594|gb|EGP83695.1| hypothetical protein MYCGRDRAFT_82510 [Zymoseptoria tritici IPO323] Length = 65 Score = 100 bits (249), Expect = 2e-19 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = +2 Query: 80 HKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 HKNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTMKALKEVKEG RDAA Sbjct: 17 HKNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 65 >ref|XP_003171468.1| 60S ribosomal protein L29 [Arthroderma gypseum CBS 118893] gi|311343811|gb|EFR03014.1| 60S ribosomal protein L29 [Arthroderma gypseum CBS 118893] Length = 65 Score = 100 bits (249), Expect = 2e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 77 AHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 AH+NGIKKPKT RYPSLKGTDPKFRRNHRHALHGTMKALKEVKEG RD+A Sbjct: 16 AHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA 65 >ref|XP_002846081.1| 60S ribosomal protein L29 [Arthroderma otae CBS 113480] gi|238843469|gb|EEQ33131.1| conserved hypothetical protein [Arthroderma otae CBS 113480] gi|326476329|gb|EGE00339.1| 60S ribosomal protein L29 [Trichophyton tonsurans CBS 112818] gi|607892685|gb|EZF32010.1| 60S ribosomal protein L29 [Trichophyton interdigitale H6] gi|607943201|gb|EZF76196.1| 60S ribosomal protein L29 [Trichophyton soudanense CBS 452.61] gi|607979708|gb|EZG08705.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 735.88] Length = 65 Score = 100 bits (249), Expect = 2e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 77 AHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 AH+NGIKKPKT RYPSLKGTDPKFRRNHRHALHGTMKALKEVKEG RD+A Sbjct: 16 AHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA 65 >emb|CCX09672.1| Similar to 60S ribosomal protein L29; acc. no. P05747 [Pyronema omphalodes CBS 100304] Length = 65 Score = 100 bits (248), Expect = 3e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +2 Query: 77 AHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 AH+NGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKE+KEG R+ A Sbjct: 16 AHRNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKELKEGKRETA 65 >gb|EON68946.1| 60S ribosomal protein L29 [Coniosporium apollinis CBS 100218] Length = 65 Score = 100 bits (248), Expect = 3e-19 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = +2 Query: 80 HKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 HKNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM+ALKEVKEG RDAA Sbjct: 17 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRDAA 65 >ref|XP_003233161.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 118892] gi|326464467|gb|EGD89920.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 118892] gi|607880408|gb|EZF25263.1| 60S ribosomal protein L29 [Trichophyton rubrum MR850] gi|607907085|gb|EZF44258.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 100081] gi|607919218|gb|EZF54948.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 288.86] gi|607931271|gb|EZF65566.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 289.86] gi|607955288|gb|EZF86859.1| 60S ribosomal protein L29 [Trichophyton rubrum MR1448] gi|607967496|gb|EZF97649.1| 60S ribosomal protein L29 [Trichophyton rubrum MR1459] gi|607991495|gb|EZG19185.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 202.88] Length = 65 Score = 99.8 bits (247), Expect = 4e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 77 AHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 AH+NGIKKPKT RYPSLKGTDPKFRRNHRHALHGTMKALKEVKEG RD+A Sbjct: 16 AHRNGIKKPKTDRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA 65 >ref|XP_002792319.1| 60S ribosomal protein L29 [Paracoccidioides sp. 'lutzii' Pb01] gi|226278989|gb|EEH34555.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] Length = 65 Score = 99.0 bits (245), Expect = 6e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +2 Query: 77 AHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 AH+NGIKKPKT RYPSLKGTDPKFRRNHRHALHGTMKALKEVKEG R++A Sbjct: 16 AHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRESA 65 >gb|EEH11222.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR] gi|240279767|gb|EER43272.1| conserved hypothetical protein [Ajellomyces capsulatus H143] gi|325092897|gb|EGC46207.1| conserved hypothetical protein [Ajellomyces capsulatus H88] Length = 65 Score = 99.0 bits (245), Expect = 6e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +2 Query: 77 AHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 AH+NGIKKPKT RYPSLKGTDPKFRRNHRHALHGTMKALKEVKEG R++A Sbjct: 16 AHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRESA 65 >ref|XP_001936717.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983816|gb|EDU49304.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 111 Score = 99.0 bits (245), Expect = 6e-19 Identities = 50/76 (65%), Positives = 55/76 (72%), Gaps = 2/76 (2%) Frame = +2 Query: 5 HTDRHTTET--MAXXXXXXXXXXXXXAHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHG 178 HT + T+ T MA H+NGIKKPKT RYPSLKGTDPKFRRNHRHALHG Sbjct: 36 HTAKSTSTTVAMAKSKNSSQHNQSKKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHG 95 Query: 179 TMKALKEVKEGVRDAA 226 TM+ALKEVKEG RD+A Sbjct: 96 TMRALKEVKEGKRDSA 111 >ref|XP_001805871.1| hypothetical protein SNOG_15733 [Phaeosphaeria nodorum SN15] gi|160705566|gb|EAT76828.2| hypothetical protein SNOG_15733 [Phaeosphaeria nodorum SN15] Length = 65 Score = 99.0 bits (245), Expect = 6e-19 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +2 Query: 80 HKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 H+NGIKKPKT RYPSLKGTDPKFRRNHRHALHGTMKALKEVKEG RD+A Sbjct: 17 HRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA 65 >ref|XP_001540942.1| predicted protein [Ajellomyces capsulatus NAm1] gi|150412885|gb|EDN08272.1| predicted protein [Ajellomyces capsulatus NAm1] Length = 176 Score = 99.0 bits (245), Expect = 6e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +2 Query: 77 AHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 AH+NGIKKPKT RYPSLKGTDPKFRRNHRHALHGTMKALKEVKEG R++A Sbjct: 127 AHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRESA 176 >gb|EXJ87049.1| large subunit ribosomal protein L29e [Capronia epimyces CBS 606.96] Length = 65 Score = 97.8 bits (242), Expect = 1e-18 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +2 Query: 77 AHKNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGVRDAA 226 AH+NGIKKPKT RYPSL GTDPKFRRNHRHALHGTMKALKEVKEG R+AA Sbjct: 16 AHRNGIKKPKTHRYPSLAGTDPKFRRNHRHALHGTMKALKEVKEGKREAA 65