BLASTX nr result
ID: Akebia25_contig00034866
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00034866 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME38377.1| hypothetical protein DOTSEDRAFT_48613 [Dothistrom... 68 2e-09 gb|EMC93326.1| hypothetical protein BAUCODRAFT_236110 [Baudoinia... 60 2e-07 gb|EMF10617.1| p53-like transcription factor [Sphaerulina musiva... 57 2e-06 >gb|EME38377.1| hypothetical protein DOTSEDRAFT_48613 [Dothistroma septosporum NZE10] Length = 593 Score = 67.8 bits (164), Expect = 2e-09 Identities = 49/112 (43%), Positives = 60/112 (53%), Gaps = 4/112 (3%) Frame = -3 Query: 325 SLAYTNYPGAHYTNVQHLPGPVQLTQTFVPSTFAEARPSTLLDTSTHMLPPP---QRHMT 155 SLAYTNY H T V PV L Q FVPS +A +R +LD S+ MLPPP + ++ Sbjct: 11 SLAYTNYHQNHCTAVPSYGAPVPLPQAFVPSAYANSRVPPILD-SSGMLPPPYPIRSPLS 69 Query: 154 SLPQPDTFSASSTPYLNRTQL-PAPAFPTYSTYAFAETPRSVLSGTAQLSLS 2 S +TP L R QL P P +++Y ETPRS LS LSLS Sbjct: 70 SSTHATERETYTTPSLARPQLSPGGYQPGFASY--PETPRSALSSITGLSLS 119 >gb|EMC93326.1| hypothetical protein BAUCODRAFT_236110 [Baudoinia compniacensis UAMH 10762] Length = 724 Score = 60.5 bits (145), Expect = 2e-07 Identities = 34/87 (39%), Positives = 46/87 (52%), Gaps = 2/87 (2%) Frame = -3 Query: 322 LAYTNYPGAHYTNVQHLPGPVQLTQTFVPSTFAEARPSTLLDTSTHMLPPPQRH--MTSL 149 LAYT YP HYT + G V L Q+FVPS+ AR S L +T +L P R + + Sbjct: 163 LAYTTYPTNHYTGLPTYTGSVSLPQSFVPSSLTGARISEGLHGATSVLTPLPRPPIVGDV 222 Query: 148 PQPDTFSASSTPYLNRTQLPAPAFPTY 68 + +T++ + YL QLP P F Y Sbjct: 223 SERETYATGAARYLTHQQLPQPGFSAY 249 >gb|EMF10617.1| p53-like transcription factor [Sphaerulina musiva SO2202] Length = 695 Score = 57.4 bits (137), Expect = 2e-06 Identities = 43/111 (38%), Positives = 58/111 (52%), Gaps = 4/111 (3%) Frame = -3 Query: 325 SLAYTNYPGAHYTNVQHLPGPVQLTQTFVP-STFAEARPSTLLDTSTHMLPPP---QRHM 158 SLAYTNYP H T++ G VQ Q F ++ R LD+ +PPP Sbjct: 118 SLAYTNYPHTHCTSIPSFSGSVQQPQAFTQLPSYNSTRELPNLDSIGSGMPPPAIRPSFS 177 Query: 157 TSLPQPDTFSASSTPYLNRTQLPAPAFPTYSTYAFAETPRSVLSGTAQLSL 5 +S + +S +STP+L RTQ + P YS +FA+TPR+ L G LSL Sbjct: 178 SSAADREAYS-NSTPFLARTQFSPGSAPGYS--SFADTPRTSL-GLNGLSL 224