BLASTX nr result
ID: Akebia25_contig00034842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00034842 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_010851850.1| conserved hypothetical protein [Tetrasphaera... 108 2e-22 ref|WP_009187518.1| hypothetical protein [Streptomyces sp. e14] ... 102 4e-20 ref|WP_009191001.1| hypothetical protein [Streptomyces sp. e14] ... 100 4e-19 ref|WP_004929700.1| hypothetical protein [Streptomyces griseofla... 98 1e-18 ref|WP_007263335.1| conserved hypothetical protein, partial [Str... 95 9e-18 ref|WP_008364245.1| hypothetical protein [Nocardioidaceae bacter... 94 2e-17 ref|WP_009233527.1| hypothetical protein [Actinomyces sp. oral t... 93 4e-17 ref|WP_009081422.1| conserved hypothetical protein [Streptomyces... 91 1e-16 gb|AGO88040.1| hypothetical protein [uncultured bacterium 122006... 82 1e-13 ref|WP_009188948.1| hypothetical protein [Streptomyces sp. e14] ... 77 3e-12 ref|WP_009187880.1| hypothetical protein [Streptomyces sp. e14] ... 77 3e-12 ref|WP_008728019.1| hypothetical protein, partial [Erysipelotric... 51 3e-12 ref|WP_001543366.1| hypothetical protein, partial [Escherichia c... 75 1e-11 ref|WP_021554219.1| hypothetical protein, partial [Escherichia c... 74 3e-11 ref|WP_001401842.1| hypothetical protein, partial [Escherichia c... 73 5e-11 ref|WP_009188947.1| hypothetical protein [Streptomyces sp. e14] ... 71 1e-10 ref|WP_001515692.1| hypothetical protein, partial [Escherichia c... 67 2e-09 ref|WP_009067872.1| conserved hypothetical protein, partial [Str... 65 1e-08 ref|WP_001348230.1| hypothetical protein [Escherichia coli] gi|3... 64 3e-08 ref|WP_004846360.1| hypothetical protein [[Ruminococcus] torques... 59 5e-07 >ref|WP_010851850.1| conserved hypothetical protein [Tetrasphaera elongata] gi|478759114|emb|CCH69100.1| conserved hypothetical protein [Tetrasphaera elongata Lp2] Length = 130 Score = 108 bits (269), Expect(2) = 2e-22 Identities = 60/79 (75%), Positives = 62/79 (78%) Frame = -1 Query: 291 RVSVPVWPVTLSGRLPVVALVSHYLTNKLIGRESIQNR*IFPTPTMR*ALLSGIRPSFPG 112 RVSVPVWPV LSGRLPVVALVSHYLTNKLIGRESI +R F T M L+SGI F Sbjct: 23 RVSVPVWPVALSGRLPVVALVSHYLTNKLIGRESIPDRKTFQTVEMPLRLVSGISSCFQL 82 Query: 111 LSQS*GQVTHVLLTRSPLI 55 L QS GQVTHVLLTRSPLI Sbjct: 83 LFQSLGQVTHVLLTRSPLI 101 Score = 23.1 bits (48), Expect(2) = 2e-22 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 29 PFDLHVLST 3 PFDLHVLST Sbjct: 109 PFDLHVLST 117 >ref|WP_009187518.1| hypothetical protein [Streptomyces sp. e14] gi|292831588|gb|EFF89937.1| hypothetical protein SSTG_00255 [Streptomyces sp. e14] Length = 86 Score = 102 bits (255), Expect = 4e-20 Identities = 54/74 (72%), Positives = 58/74 (78%) Frame = -1 Query: 276 VWPVTLSGRLPVVALVSHYLTNKLIGRESIQNR*IFPTPTMR*ALLSGIRPSFPGLSQS* 97 +WPV LSGRLPVVALVSHYLTNKLIGR I +R FP M L+SGIRP F GLSQS Sbjct: 1 MWPVALSGRLPVVALVSHYLTNKLIGRGLILHRRSFPASKMPRRLVSGIRPRFQGLSQSE 60 Query: 96 GQVTHVLLTRSPLI 55 GQ+ HVLLTRSPLI Sbjct: 61 GQIAHVLLTRSPLI 74 >ref|WP_009191001.1| hypothetical protein [Streptomyces sp. e14] gi|292835109|gb|EFF93458.1| hypothetical protein SSTG_03777 [Streptomyces sp. e14] Length = 86 Score = 99.8 bits (247), Expect = 4e-19 Identities = 53/74 (71%), Positives = 57/74 (77%) Frame = -1 Query: 276 VWPVTLSGRLPVVALVSHYLTNKLIGRESIQNR*IFPTPTMR*ALLSGIRPSFPGLSQS* 97 +WPV LSGRLPVVALVS YLTNKLIGR I +R FP M L+SGIRP F GLSQS Sbjct: 1 MWPVALSGRLPVVALVSRYLTNKLIGRGLILHRRSFPASKMPWRLVSGIRPRFQGLSQSE 60 Query: 96 GQVTHVLLTRSPLI 55 GQ+ HVLLTRSPLI Sbjct: 61 GQIAHVLLTRSPLI 74 >ref|WP_004929700.1| hypothetical protein [Streptomyces griseoflavus] gi|302477482|gb|EFL40575.1| hypothetical protein SSRG_03379 [Streptomyces griseoflavus Tu4000] Length = 86 Score = 98.2 bits (243), Expect = 1e-18 Identities = 52/74 (70%), Positives = 57/74 (77%) Frame = -1 Query: 276 VWPVTLSGRLPVVALVSHYLTNKLIGRESIQNR*IFPTPTMR*ALLSGIRPSFPGLSQS* 97 +WPV LSGRLPVVALVSHYLTNKLIGR I +R F M ++SGIRP F GLSQS Sbjct: 1 MWPVALSGRLPVVALVSHYLTNKLIGRGLILHRRSFQPLQMPAGVISGIRPRFQGLSQSE 60 Query: 96 GQVTHVLLTRSPLI 55 GQ+ HVLLTRSPLI Sbjct: 61 GQIAHVLLTRSPLI 74 >ref|WP_007263335.1| conserved hypothetical protein, partial [Streptomyces sp. C] gi|302442572|gb|EFL14388.1| conserved hypothetical protein [Streptomyces sp. C] Length = 84 Score = 95.1 bits (235), Expect = 9e-18 Identities = 51/72 (70%), Positives = 55/72 (76%) Frame = -1 Query: 270 PVTLSGRLPVVALVSHYLTNKLIGRESIQNR*IFPTPTMR*ALLSGIRPSFPGLSQS*GQ 91 PV LSGRLPVVALV HY TNKLIGR I +R F P M+ +LSGIRP F GLSQS GQ Sbjct: 1 PVALSGRLPVVALVGHYPTNKLIGRGLILHRRSFQLPPMQAGVLSGIRPRFQGLSQSEGQ 60 Query: 90 VTHVLLTRSPLI 55 + HVLLTRSPLI Sbjct: 61 IAHVLLTRSPLI 72 >ref|WP_008364245.1| hypothetical protein [Nocardioidaceae bacterium Broad-1] gi|325947935|gb|EGD40054.1| hypothetical protein NBCG_05699 [Nocardioidaceae bacterium Broad-1] Length = 86 Score = 94.0 bits (232), Expect = 2e-17 Identities = 50/73 (68%), Positives = 55/73 (75%) Frame = -1 Query: 276 VWPVTLSGRLPVVALVSHYLTNKLIGRESIQNR*IFPTPTMR*ALLSGIRPSFPGLSQS* 97 +WPVTLSGRLPV ALVSHYLTNKLIGRE I R F M+ ++SGI F LSQS Sbjct: 1 MWPVTLSGRLPVEALVSHYLTNKLIGREHIPGRKTFHNHPMQEVVVSGINHRFRWLSQSL 60 Query: 96 GQVTHVLLTRSPL 58 GQ+THVLLTRSPL Sbjct: 61 GQITHVLLTRSPL 73 >ref|WP_009233527.1| hypothetical protein [Actinomyces sp. oral taxon 849] gi|365264633|gb|EHM94433.1| hypothetical protein HMPREF0975_01540 [Actinomyces sp. oral taxon 849 str. F0330] Length = 255 Score = 92.8 bits (229), Expect = 4e-17 Identities = 57/98 (58%), Positives = 63/98 (64%), Gaps = 6/98 (6%) Frame = -1 Query: 276 VWPVTLSGRLPVVALVSHYLTNKLIGRESIQNR-----*IFPTPTMR*ALLSGIRPSFPG 112 +WP TLSGRLPV ALV H+ TNKLIGRE I +R FP P + I P+F Sbjct: 1 MWPSTLSGRLPVTALVGHHPTNKLIGREPIPHRKHPKAQSFPNPPCDRPGIPRISPTFMR 60 Query: 111 LSQS*GQVTHVLLTRSPLIR-RSKLLPVTVRLACVKHA 1 LS+ GQVTHVLLTRSPLI K TVRLACVKHA Sbjct: 61 LSRRRGQVTHVLLTRSPLIHTHQKGKRFTVRLACVKHA 98 >ref|WP_009081422.1| conserved hypothetical protein [Streptomyces sp. AA4] gi|302438014|gb|EFL09830.1| conserved hypothetical protein [Streptomyces sp. AA4] Length = 121 Score = 91.3 bits (225), Expect = 1e-16 Identities = 52/79 (65%), Positives = 59/79 (74%), Gaps = 1/79 (1%) Frame = -1 Query: 234 LVSHYLTNKLIGRESIQNR*IFPTPTMR*ALLSGIRPSFPGLSQS*GQVTHVLLTRSPLI 55 +V HY TNKLIGR I R FP P M ++SGIRPSFPGLSQS GQ+THVLLTRSPLI Sbjct: 1 MVGHYPTNKLIGRGFIPYRRNFPPPQMPAVVVSGIRPSFPGLSQSTGQITHVLLTRSPLI 60 Query: 54 -RRSKLLPVTVRLACVKHA 1 R++ +VRLACVKHA Sbjct: 61 PGRNRF---SVRLACVKHA 76 >gb|AGO88040.1| hypothetical protein [uncultured bacterium 122006-I05] Length = 162 Score = 81.6 bits (200), Expect = 1e-13 Identities = 45/81 (55%), Positives = 55/81 (67%), Gaps = 3/81 (3%) Frame = -1 Query: 291 RVSVPVWPVTLSGRLPVVALVSHYLTNKLIGRESIQN---R*IFPTPTMR*ALLSGIRPS 121 R+S+PVW + LS +LP++ALVS YLTNKLIG IQ + T A LSGI P+ Sbjct: 51 RISIPVWLIILSDQLPIIALVSFYLTNKLIGHRPIQKHDPKTALTTYPKGFAALSGISPA 110 Query: 120 FPGLSQS*GQVTHVLLTRSPL 58 F GLSQS GQVT+ LLTR P+ Sbjct: 111 FAGLSQSLGQVTYALLTRPPV 131 >ref|WP_009188948.1| hypothetical protein [Streptomyces sp. e14] gi|292833026|gb|EFF91375.1| hypothetical protein SSTG_01694 [Streptomyces sp. e14] gi|292833487|gb|EFF91836.1| hypothetical protein SSTG_02155 [Streptomyces sp. e14] Length = 72 Score = 77.0 bits (188), Expect = 3e-12 Identities = 41/60 (68%), Positives = 45/60 (75%) Frame = -1 Query: 234 LVSHYLTNKLIGRESIQNR*IFPTPTMR*ALLSGIRPSFPGLSQS*GQVTHVLLTRSPLI 55 +VSHYLTNKLIGR I +R FP M L+SGIRP F GLSQS GQ+ HVLLTRSPLI Sbjct: 1 MVSHYLTNKLIGRGLILHRRSFPASKMPRRLVSGIRPRFQGLSQSEGQIAHVLLTRSPLI 60 >ref|WP_009187880.1| hypothetical protein [Streptomyces sp. e14] gi|292831953|gb|EFF90302.1| hypothetical protein SSTG_00620 [Streptomyces sp. e14] gi|292834016|gb|EFF92365.1| hypothetical protein SSTG_02684 [Streptomyces sp. e14] Length = 72 Score = 77.0 bits (188), Expect = 3e-12 Identities = 41/60 (68%), Positives = 45/60 (75%) Frame = -1 Query: 234 LVSHYLTNKLIGRESIQNR*IFPTPTMR*ALLSGIRPSFPGLSQS*GQVTHVLLTRSPLI 55 +VSHYLTNKLIGR I +R FP M L+SGIRP F GLSQS GQ+ HVLLTRSPLI Sbjct: 1 MVSHYLTNKLIGRGLILHRRSFPASKMPWRLVSGIRPRFQGLSQSEGQIAHVLLTRSPLI 60 >ref|WP_008728019.1| hypothetical protein, partial [Erysipelotrichaceae bacterium 2_2_44A] gi|345905407|gb|EGX75147.1| hypothetical protein HMPREF9022_02480 [Erysipelotrichaceae bacterium 2_2_44A] Length = 196 Score = 51.2 bits (121), Expect(2) = 3e-12 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -1 Query: 159 TMR*ALLSGIRPSFPGLSQS*GQVTHVLLTRSPL-IRRSKLLPVTVRLACVKHA 1 +MR LSG F LS++ GQVT+VLLTRSPL + SKL V VRLAC++HA Sbjct: 40 SMRSVYLSGFSYRFQQLSRTHGQVTYVLLTRSPLSLFGSKLPRVFVRLACIRHA 93 Score = 45.8 bits (107), Expect(2) = 3e-12 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = -3 Query: 265 HPLRPATRRRLGEPLPHQQADRPRVHP 185 +PLRPAT RLG PLPHQ A+ P+VHP Sbjct: 2 YPLRPATHHRLGGPLPHQLANAPQVHP 28 >ref|WP_001543366.1| hypothetical protein, partial [Escherichia coli] gi|431003121|gb|ELD18608.1| hypothetical protein A15U_04539, partial [Escherichia coli KTE210] Length = 151 Score = 74.7 bits (182), Expect = 1e-11 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 3/100 (3%) Frame = -1 Query: 291 RVSVPVWPVTLSGRLPVVALVSHYLTNKLIGRESIQNR*IFPTPTM---R*ALLSGIRPS 121 RVSVPVW V LS +L +VALVS Y TNKLI I+ + +P++ R A+L+ + S Sbjct: 48 RVSVPVWLVILSDQLGIVALVSRYPTNKLIPSGHIRWQEARRSPSLVLRRYAVLATVSSS 107 Query: 120 FPGLSQS*GQVTHVLLTRSPLIRRSKLLPVTVRLACVKHA 1 +P S S +TH TR +RSKLLPVTVRLACV+ A Sbjct: 108 YPPPSGSFPDITHPSATRQ---QRSKLLPVTVRLACVRPA 144 >ref|WP_021554219.1| hypothetical protein, partial [Escherichia coli] gi|535498309|gb|EQW37646.1| hypothetical protein G903_04242, partial [Escherichia coli UMEA 3053-1] Length = 146 Score = 73.6 bits (179), Expect = 3e-11 Identities = 49/100 (49%), Positives = 63/100 (63%), Gaps = 3/100 (3%) Frame = -1 Query: 291 RVSVPVWPVTLSGRLPVVALVSHYLTNKLIGRESIQNR*IFPTPTM---R*ALLSGIRPS 121 RVSVPVW V LS +L +VALVS Y TNKLI I+ + +P++ R A+L+ + S Sbjct: 43 RVSVPVWLVILSDQLGIVALVSRYPTNKLIPSGHIRWQEALRSPSLVLRRYAVLATVSSS 102 Query: 120 FPGLSQS*GQVTHVLLTRSPLIRRSKLLPVTVRLACVKHA 1 +P S S +TH TR + SKLLPVTVRLACV+ A Sbjct: 103 YPPPSGSFPDITHPSATRQ---QSSKLLPVTVRLACVRPA 139 >ref|WP_001401842.1| hypothetical protein, partial [Escherichia coli] gi|429439347|gb|EKZ75334.1| hypothetical protein O7E_02948, partial [Escherichia coli O104:H4 str. Ec11-5604] gi|429441943|gb|EKZ77907.1| hypothetical protein S7Y_04888, partial [Escherichia coli O104:H4 str. Ec12-0465] gi|429458824|gb|EKZ94644.1| hypothetical protein MO7_05239, partial [Escherichia coli O104:H4 str. Ec11-9941] Length = 151 Score = 72.8 bits (177), Expect = 5e-11 Identities = 49/100 (49%), Positives = 62/100 (62%), Gaps = 3/100 (3%) Frame = -1 Query: 291 RVSVPVWPVTLSGRLPVVALVSHYLTNKLIGRESIQNR*IFPTPTM---R*ALLSGIRPS 121 RVSVPVW V LS +L +VALVS Y TNKLI I+ + +P++ R A+L+ + S Sbjct: 48 RVSVPVWLVILSDQLGIVALVSRYPTNKLIPSGHIRWQEARRSPSLVLRRYAVLATVSSS 107 Query: 120 FPGLSQS*GQVTHVLLTRSPLIRRSKLLPVTVRLACVKHA 1 +P S S +TH TR R SKL PVTVRLACV+ A Sbjct: 108 YPPPSGSFPDITHPSATRQ---RNSKLFPVTVRLACVRPA 144 >ref|WP_009188947.1| hypothetical protein [Streptomyces sp. e14] gi|292833025|gb|EFF91374.1| hypothetical protein SSTG_01693 [Streptomyces sp. e14] gi|292833486|gb|EFF91835.1| hypothetical protein SSTG_02154 [Streptomyces sp. e14] gi|292834017|gb|EFF92366.1| hypothetical protein SSTG_02685 [Streptomyces sp. e14] Length = 55 Score = 71.2 bits (173), Expect = 1e-10 Identities = 38/55 (69%), Positives = 40/55 (72%) Frame = +1 Query: 82 VSNLPLTLG*AWETGSNTG*ERLPHGGCWKDLSVLDGLAAYQLVGEVMAHQGDDG 246 + NLP TLG A ETGSNTG E H G WK +V D AAYQLVGEVMAHQGDDG Sbjct: 1 MGNLPFTLGQALETGSNTGYEPPRHLGGWKAPAVKDEPAAYQLVGEVMAHQGDDG 55 >ref|WP_001515692.1| hypothetical protein, partial [Escherichia coli] gi|430883699|gb|ELC06673.1| hypothetical protein WCM_04769, partial [Escherichia coli KTE10] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 47/100 (47%), Positives = 61/100 (61%), Gaps = 3/100 (3%) Frame = -1 Query: 291 RVSVPVWPVTLSGRLPVVALVSHYLTNKLIGRESIQNR*IFPTPTM---R*ALLSGIRPS 121 RVSVPVW V LS +L +VALVS Y TNKLI I+ + +P++ A+L+ + S Sbjct: 48 RVSVPVWLVILSDQLGIVALVSRYPTNKLIPSGHIRWQEARRSPSLVLRHYAVLATVSSS 107 Query: 120 FPGLSQS*GQVTHVLLTRSPLIRRSKLLPVTVRLACVKHA 1 +P S S +TH TR + SKLL VTVRLACV+ A Sbjct: 108 YPPPSGSFPDITHPSATRQ---QSSKLLSVTVRLACVRPA 144 >ref|WP_009067872.1| conserved hypothetical protein, partial [Streptomyces sp. SPB78] gi|302429949|gb|EFL01765.1| conserved hypothetical protein [Streptomyces sp. SPB78] Length = 69 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/57 (59%), Positives = 37/57 (64%) Frame = -3 Query: 262 PLRPATRRRLGEPLPHQQADRPRVHPKPINLSNTHHAVGAPIRY*TQFPRLIPELRA 92 PLRPATRRRLGEPLPHQ ADRPR HP P LS A G +++P L P RA Sbjct: 2 PLRPATRRRLGEPLPHQLADRPRAHPAPPELSTAKDAQG------SEYPVLDPVSRA 52 >ref|WP_001348230.1| hypothetical protein [Escherichia coli] gi|342926033|gb|EGU94755.1| hypothetical protein HMPREF9349_05376 [Escherichia coli MS 79-10] Length = 99 Score = 63.5 bits (153), Expect = 3e-08 Identities = 44/95 (46%), Positives = 58/95 (61%), Gaps = 3/95 (3%) Frame = -1 Query: 276 VWPVTLSGRLPVVALVSHYLTNKLIGRESIQNR*IFPTPTM---R*ALLSGIRPSFPGLS 106 +W V LS +L +VALVS Y TNKLI I+ + +P++ R A+L+ + S+P S Sbjct: 1 MWLVILSDQLGIVALVSRYPTNKLIPSGHIRWQEARRSPSLVLRRYAVLATVSSSYPPPS 60 Query: 105 QS*GQVTHVLLTRSPLIRRSKLLPVTVRLACVKHA 1 S +TH TR R SKLLPVTVRLACV+ A Sbjct: 61 GSFPDITHPSATRQ---RSSKLLPVTVRLACVRPA 92 >ref|WP_004846360.1| hypothetical protein [[Ruminococcus] torques] gi|145846017|gb|EDK22935.1| hypothetical protein RUMTOR_02906 [Ruminococcus torques ATCC 27756] Length = 103 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = -1 Query: 291 RVSVPVWPVTLSGRLPVVALVSHYLTNKLIGRESIQNR*IFPTPTMR 151 RVSVP+WPVTLSGRL +VALVS YLTN+LI R SI F TMR Sbjct: 50 RVSVPMWPVTLSGRLLIVALVSRYLTNQLIRRGSISYHRSFYPRTMR 96