BLASTX nr result
ID: Akebia25_contig00034644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00034644 (216 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004305761.1| PREDICTED: exocyst complex component 7-like ... 71 2e-10 ref|XP_007024675.1| Exocyst subunit exo70 family protein D2 [The... 70 4e-10 ref|XP_007214942.1| hypothetical protein PRUPE_ppa002868mg [Prun... 70 4e-10 ref|XP_006369121.1| exocyst subunit EXO70 family protein [Populu... 70 4e-10 ref|XP_002303234.2| exocyst subunit EXO70 family protein [Populu... 69 5e-10 ref|XP_006465885.1| PREDICTED: exocyst complex component EXO70A1... 69 7e-10 ref|XP_002532729.1| protein binding protein, putative [Ricinus c... 68 1e-09 ref|XP_007135417.1| hypothetical protein PHAVU_010G127600g [Phas... 68 1e-09 ref|XP_006392721.1| hypothetical protein EUTSA_v10011317mg [Eutr... 68 1e-09 ref|XP_006342931.1| PREDICTED: exocyst complex component 7-like ... 67 2e-09 ref|XP_006306998.1| hypothetical protein CARUB_v10008575mg [Caps... 67 2e-09 ref|XP_004235557.1| PREDICTED: exocyst complex component 7-like ... 67 2e-09 ref|XP_004235556.1| PREDICTED: exocyst complex component 7-like ... 67 2e-09 ref|NP_175811.1| exocyst subunit exo70 family protein D2 [Arabid... 67 2e-09 ref|XP_006426703.1| hypothetical protein CICLE_v10025154mg [Citr... 67 3e-09 ref|XP_002272396.2| PREDICTED: exocyst complex component 7-like ... 67 3e-09 ref|XP_002891787.1| ATEXO70D2 [Arabidopsis lyrata subsp. lyrata]... 67 3e-09 emb|CBI35844.3| unnamed protein product [Vitis vinifera] 67 3e-09 ref|XP_003529840.2| PREDICTED: exocyst complex component EXO70A1... 66 4e-09 ref|XP_004510526.1| PREDICTED: exocyst complex component 7-like ... 66 4e-09 >ref|XP_004305761.1| PREDICTED: exocyst complex component 7-like [Fragaria vesca subsp. vesca] Length = 623 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++R HIESGKHPE YIKYSV+DLE A+LDFFEG++VS H R+ Sbjct: 579 RFRSHIESGKHPENYIKYSVEDLETAVLDFFEGYSVSQHLRR 620 >ref|XP_007024675.1| Exocyst subunit exo70 family protein D2 [Theobroma cacao] gi|508780041|gb|EOY27297.1| Exocyst subunit exo70 family protein D2 [Theobroma cacao] Length = 620 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++R HIESGKHPE YIKYSV+DLE A+LDFFEG+ VS H R+ Sbjct: 576 RFRSHIESGKHPENYIKYSVEDLETAVLDFFEGNPVSQHLRR 617 >ref|XP_007214942.1| hypothetical protein PRUPE_ppa002868mg [Prunus persica] gi|462411092|gb|EMJ16141.1| hypothetical protein PRUPE_ppa002868mg [Prunus persica] Length = 626 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++R HIESG+HPE YIKYSV+DLE A+LDFFEG++VS H R+ Sbjct: 582 RFRSHIESGRHPENYIKYSVEDLETAVLDFFEGYSVSQHLRR 623 >ref|XP_006369121.1| exocyst subunit EXO70 family protein [Populus trichocarpa] gi|550347481|gb|ERP65690.1| exocyst subunit EXO70 family protein [Populus trichocarpa] Length = 610 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++R HIESGKHPE YIKYSV+DLE A+LDFFEG+ VS H R+ Sbjct: 566 RFRSHIESGKHPENYIKYSVEDLESAVLDFFEGYPVSQHLRR 607 >ref|XP_002303234.2| exocyst subunit EXO70 family protein [Populus trichocarpa] gi|550342569|gb|EEE78213.2| exocyst subunit EXO70 family protein [Populus trichocarpa] Length = 629 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++R HIESGKHPE YIKYSV+DLE A+LDFFEG+ VS H R+ Sbjct: 585 RFRSHIESGKHPENYIKYSVEDLENAVLDFFEGYPVSQHLRR 626 >ref|XP_006465885.1| PREDICTED: exocyst complex component EXO70A1-like [Citrus sinensis] Length = 630 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++R HIESGKHPE YIKYSV+DLE ++LDFFEG+ VS H R+ Sbjct: 586 RFRSHIESGKHPENYIKYSVEDLETSVLDFFEGYPVSQHLRR 627 >ref|XP_002532729.1| protein binding protein, putative [Ricinus communis] gi|223527537|gb|EEF29660.1| protein binding protein, putative [Ricinus communis] Length = 616 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++R HIESGKHPE Y+KYSV+DLE A+LDFFEG+ VS H R+ Sbjct: 572 RFRSHIESGKHPENYMKYSVEDLENAVLDFFEGYPVSQHLRR 613 >ref|XP_007135417.1| hypothetical protein PHAVU_010G127600g [Phaseolus vulgaris] gi|561008462|gb|ESW07411.1| hypothetical protein PHAVU_010G127600g [Phaseolus vulgaris] Length = 604 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++RGHIESG+HPE YIKY+V+DLE A+LDFFEG VS H R+ Sbjct: 560 RFRGHIESGRHPENYIKYTVEDLEDAVLDFFEGIAVSQHLRR 601 >ref|XP_006392721.1| hypothetical protein EUTSA_v10011317mg [Eutrema salsugineum] gi|557089299|gb|ESQ30007.1| hypothetical protein EUTSA_v10011317mg [Eutrema salsugineum] Length = 628 Score = 67.8 bits (164), Expect = 1e-09 Identities = 27/42 (64%), Positives = 37/42 (88%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++RGHIESG+HPE Y+KYSV+DLE A+LDFFEG++ + H R+ Sbjct: 584 RFRGHIESGRHPENYLKYSVEDLETAVLDFFEGYSTAPHLRR 625 >ref|XP_006342931.1| PREDICTED: exocyst complex component 7-like isoform X1 [Solanum tuberosum] gi|565351994|ref|XP_006342932.1| PREDICTED: exocyst complex component 7-like isoform X2 [Solanum tuberosum] gi|565351996|ref|XP_006342933.1| PREDICTED: exocyst complex component 7-like isoform X3 [Solanum tuberosum] Length = 608 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++R HIESG+HPE YIKY+V+DLE A+LDFFEG+ VS H R+ Sbjct: 564 RFRSHIESGRHPENYIKYTVEDLENAVLDFFEGYAVSQHLRR 605 >ref|XP_006306998.1| hypothetical protein CARUB_v10008575mg [Capsella rubella] gi|482575709|gb|EOA39896.1| hypothetical protein CARUB_v10008575mg [Capsella rubella] Length = 629 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/42 (64%), Positives = 37/42 (88%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++RGHIESG+HPE Y+KYSV++LE A+LDFFEG+T + H R+ Sbjct: 586 RFRGHIESGRHPENYLKYSVENLETAVLDFFEGYTTAPHLRR 627 >ref|XP_004235557.1| PREDICTED: exocyst complex component 7-like isoform 2 [Solanum lycopersicum] Length = 570 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++R HIESG+HPE YIKY+V+DLE A+LDFFEG+ VS H R+ Sbjct: 526 RFRSHIESGRHPENYIKYTVEDLENAVLDFFEGYAVSQHLRR 567 >ref|XP_004235556.1| PREDICTED: exocyst complex component 7-like isoform 1 [Solanum lycopersicum] Length = 608 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++R HIESG+HPE YIKY+V+DLE A+LDFFEG+ VS H R+ Sbjct: 564 RFRSHIESGRHPENYIKYTVEDLENAVLDFFEGYAVSQHLRR 605 >ref|NP_175811.1| exocyst subunit exo70 family protein D2 [Arabidopsis thaliana] gi|4587550|gb|AAD25781.1|AC006577_17 EST gb|R64848 comes from this gene [Arabidopsis thaliana] gi|20260594|gb|AAM13195.1| unknown protein [Arabidopsis thaliana] gi|30725458|gb|AAP37751.1| At1g54090 [Arabidopsis thaliana] gi|110742451|dbj|BAE99144.1| hypothetical protein [Arabidopsis thaliana] gi|332194925|gb|AEE33046.1| exocyst subunit exo70 family protein D2 [Arabidopsis thaliana] Length = 622 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/42 (64%), Positives = 37/42 (88%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++RGHIESG+HPE Y+KYSV++LE A+LDFFEG+T + H R+ Sbjct: 579 RFRGHIESGRHPENYLKYSVENLETAVLDFFEGYTTAPHLRR 620 >ref|XP_006426703.1| hypothetical protein CICLE_v10025154mg [Citrus clementina] gi|557528693|gb|ESR39943.1| hypothetical protein CICLE_v10025154mg [Citrus clementina] Length = 630 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++R HIES KHPE YIKYSV+DLE ++LDFFEG+ VS H R+ Sbjct: 586 RFRSHIESSKHPENYIKYSVEDLETSVLDFFEGYPVSQHLRR 627 >ref|XP_002272396.2| PREDICTED: exocyst complex component 7-like [Vitis vinifera] Length = 611 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++R HIESG+HPE YIKYS DLE A+LDFFEG+ VS H R+ Sbjct: 567 RFRSHIESGRHPENYIKYSADDLETAVLDFFEGYPVSQHLRR 608 >ref|XP_002891787.1| ATEXO70D2 [Arabidopsis lyrata subsp. lyrata] gi|297337629|gb|EFH68046.1| ATEXO70D2 [Arabidopsis lyrata subsp. lyrata] Length = 625 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++RGHIESG+HPE Y+KYSV +LE A+LDFFEG+T + H R+ Sbjct: 582 RFRGHIESGRHPENYLKYSVDNLETAVLDFFEGYTTAPHLRR 623 >emb|CBI35844.3| unnamed protein product [Vitis vinifera] Length = 582 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++R HIESG+HPE YIKYS DLE A+LDFFEG+ VS H R+ Sbjct: 538 RFRSHIESGRHPENYIKYSADDLETAVLDFFEGYPVSQHLRR 579 >ref|XP_003529840.2| PREDICTED: exocyst complex component EXO70A1-like [Glycine max] Length = 682 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++R HIESG+HPE YIKYSV+DLE A+LDFFEG VS H R+ Sbjct: 638 RFRSHIESGRHPENYIKYSVEDLEDAVLDFFEGIPVSQHLRR 679 >ref|XP_004510526.1| PREDICTED: exocyst complex component 7-like [Cicer arietinum] Length = 628 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 215 QYRGHIESGKHPEKYIKYSVKDLEIAILDFFEGHTVSHHTRK 90 ++R HIESG+HPE YIKYSV+DLE A+LDFFEG VS H R+ Sbjct: 584 RFRSHIESGRHPENYIKYSVEDLEDAVLDFFEGIPVSQHMRR 625