BLASTX nr result
ID: Akebia25_contig00034627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00034627 (255 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] 52 1e-07 >emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] Length = 722 Score = 52.4 bits (124), Expect(2) = 1e-07 Identities = 25/43 (58%), Positives = 29/43 (67%) Frame = +3 Query: 75 GCKPNMVSFAILNHAKSVGKMKRFPVATKALEFVLSGNCVRET 203 GC+PN VS IL A S MKRFP +K LEFV+ GNC +ET Sbjct: 673 GCEPNAVSIEILKQAMSKCWMKRFPEVSKQLEFVICGNCEKET 715 Score = 29.3 bits (64), Expect(2) = 1e-07 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 4/29 (13%) Frame = +1 Query: 1 GLVPSIGILN----AMLQRSKLWDVILIL 75 GL P++ I N AM QR K WD++ +L Sbjct: 638 GLTPTVTIYNTILAAMFQRGKFWDIVSLL 666