BLASTX nr result
ID: Akebia25_contig00034590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00034590 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006435534.1| hypothetical protein CICLE_v10032209mg [Citr... 65 1e-08 ref|XP_002312099.2| hypothetical protein POPTR_0008s05620g [Popu... 65 1e-08 ref|XP_007009334.1| Uncharacterized protein isoform 2 [Theobroma... 64 2e-08 ref|XP_007009333.1| Uncharacterized protein isoform 1 [Theobroma... 64 2e-08 ref|XP_002530865.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_002315221.2| hypothetical protein POPTR_0010s21120g [Popu... 62 8e-08 ref|XP_004156706.1| PREDICTED: uncharacterized LOC101214727 [Cuc... 62 8e-08 ref|XP_004142760.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 62 8e-08 ref|XP_006846187.1| hypothetical protein AMTR_s00012p00212610 [A... 61 1e-07 emb|CBI31683.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002283687.1| PREDICTED: uncharacterized protein LOC100251... 57 3e-06 >ref|XP_006435534.1| hypothetical protein CICLE_v10032209mg [Citrus clementina] gi|568866283|ref|XP_006486486.1| PREDICTED: uncharacterized protein LOC102627296 [Citrus sinensis] gi|557537730|gb|ESR48774.1| hypothetical protein CICLE_v10032209mg [Citrus clementina] Length = 306 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = -3 Query: 264 CIGHLWRLKSSLQSEIESERPLKPINNDNNRRVKLERRRHASFRAL 127 C GHL RL+SSL SE+E+ER L PIN+DN R +KLERRRH S RAL Sbjct: 261 CRGHLKRLQSSLHSEVEAERFLNPINSDNTRWLKLERRRHFSLRAL 306 >ref|XP_002312099.2| hypothetical protein POPTR_0008s05620g [Populus trichocarpa] gi|550332489|gb|EEE89466.2| hypothetical protein POPTR_0008s05620g [Populus trichocarpa] Length = 306 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -3 Query: 264 CIGHLWRLKSSLQSEIESERPLKPINNDNNRRVKLERRRHASFRAL 127 C GHL RL+SSLQ E E ER +KPIN+DNNR +K ERR+H+ FRAL Sbjct: 261 CGGHLKRLQSSLQFETEGERLMKPINSDNNRGMKFERRKHSLFRAL 306 >ref|XP_007009334.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508726247|gb|EOY18144.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 253 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/46 (67%), Positives = 40/46 (86%) Frame = -3 Query: 264 CIGHLWRLKSSLQSEIESERPLKPINNDNNRRVKLERRRHASFRAL 127 C GHL L++SLQSE+E+ER LKPIN D++ R+KL+RRRH+SFRAL Sbjct: 208 CNGHLKGLQASLQSELEAERLLKPINIDSHWRLKLDRRRHSSFRAL 253 >ref|XP_007009333.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508726246|gb|EOY18143.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 316 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/46 (67%), Positives = 40/46 (86%) Frame = -3 Query: 264 CIGHLWRLKSSLQSEIESERPLKPINNDNNRRVKLERRRHASFRAL 127 C GHL L++SLQSE+E+ER LKPIN D++ R+KL+RRRH+SFRAL Sbjct: 271 CNGHLKGLQASLQSELEAERLLKPINIDSHWRLKLDRRRHSSFRAL 316 >ref|XP_002530865.1| conserved hypothetical protein [Ricinus communis] gi|223529589|gb|EEF31539.1| conserved hypothetical protein [Ricinus communis] Length = 307 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = -3 Query: 264 CIGHLWRLKSSLQSEIESERPLKPINNDNNRRVKLERRRHASFRAL 127 C HL RL+SSLQSE+E ER LKPIN DNN R+K ERRRH+ R L Sbjct: 262 CCEHLKRLQSSLQSEMEEERLLKPINTDNNWRMKRERRRHSLLRGL 307 >ref|XP_002315221.2| hypothetical protein POPTR_0010s21120g [Populus trichocarpa] gi|550330279|gb|EEF01392.2| hypothetical protein POPTR_0010s21120g [Populus trichocarpa] Length = 306 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = -3 Query: 264 CIGHLWRLKSSLQSEIESERPLKPINNDNNRRVKLERRRHASFRAL 127 C GHL L SSLQ E+E ER +KPI +DNN RVK ERRRH+ FRAL Sbjct: 261 CSGHLKSLPSSLQFEMEGERFVKPIKSDNNWRVKFERRRHSLFRAL 306 >ref|XP_004156706.1| PREDICTED: uncharacterized LOC101214727 [Cucumis sativus] Length = 311 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -3 Query: 264 CIGHLWRLKSSLQSEIESERPLKPINNDNNRRVKLERRRHASFRAL 127 CIGHL RL+S LQSEIE++R L+P+N DN R++K ERRRH+ R + Sbjct: 266 CIGHLKRLQSVLQSEIETDRFLRPVNGDNIRKIKSERRRHSLLRTI 311 >ref|XP_004142760.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101214727 [Cucumis sativus] Length = 312 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -3 Query: 264 CIGHLWRLKSSLQSEIESERPLKPINNDNNRRVKLERRRHASFRAL 127 CIGHL RL+S LQSEIE++R L+P+N DN R++K ERRRH+ R + Sbjct: 267 CIGHLKRLQSVLQSEIETDRFLRPVNGDNIRKIKSERRRHSLLRTI 312 >ref|XP_006846187.1| hypothetical protein AMTR_s00012p00212610 [Amborella trichopoda] gi|548848957|gb|ERN07862.1| hypothetical protein AMTR_s00012p00212610 [Amborella trichopoda] Length = 308 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -3 Query: 264 CIGHLWRLKSSLQSEIESERPLKPINNDNNRRVKLERRRHASFRA 130 CIG RLK +LQ EIE+ER LKPI NDN RRVK+ERRR FRA Sbjct: 264 CIGQFRRLKVALQCEIEAERLLKPIMNDNGRRVKVERRRQPFFRA 308 >emb|CBI31683.3| unnamed protein product [Vitis vinifera] Length = 272 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -3 Query: 264 CIGHLWRLKSSLQSEIESERPLKPINNDNNRRVKLERRRHASFRAL 127 C HL RL+ +LQ E+E+ER LKPIN+DNN R+K RRRH+S R L Sbjct: 227 CSEHLKRLQHALQLEVEAERLLKPINSDNNWRLKPGRRRHSSLRIL 272 >ref|XP_002283687.1| PREDICTED: uncharacterized protein LOC100251328 [Vitis vinifera] Length = 307 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -3 Query: 264 CIGHLWRLKSSLQSEIESERPLKPINNDNNRRVKLERRRHASFRAL 127 C HL RL+ +LQ E+E+ER LKPIN+DNN R+K RRRH+S R L Sbjct: 262 CSEHLKRLQHALQLEVEAERLLKPINSDNNWRLKPGRRRHSSLRIL 307