BLASTX nr result
ID: Akebia25_contig00034568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00034568 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006577191.1| PREDICTED: protein phosphatase 2C 32-like is... 82 6e-14 ref|XP_006491445.1| PREDICTED: protein phosphatase 2C 32-like is... 82 6e-14 ref|XP_006444652.1| hypothetical protein CICLE_v10018806mg [Citr... 82 6e-14 ref|XP_006840417.1| hypothetical protein AMTR_s00045p00156730 [A... 82 6e-14 ref|XP_007051333.1| Phosphatase 2C family protein isoform 1 [The... 82 6e-14 ref|XP_003554585.1| PREDICTED: protein phosphatase 2C 32-like [G... 82 6e-14 emb|CBI37033.3| unnamed protein product [Vitis vinifera] 82 6e-14 ref|XP_002280642.1| PREDICTED: protein phosphatase 2C 32-like [V... 82 6e-14 ref|XP_002515151.1| protein phosphatase 2c, putative [Ricinus co... 82 6e-14 emb|CAN83867.1| hypothetical protein VITISV_031357 [Vitis vinifera] 82 6e-14 ref|XP_007163261.1| hypothetical protein PHAVU_001G219500g [Phas... 81 1e-13 gb|EXB44481.1| Protein phosphatase 2C 32 [Morus notabilis] 80 3e-13 ref|XP_006397883.1| hypothetical protein EUTSA_v10001308mg [Eutr... 80 3e-13 ref|XP_006293665.1| hypothetical protein CARUB_v10022621mg [Caps... 80 3e-13 ref|XP_002882093.1| hypothetical protein ARALYDRAFT_904163 [Arab... 80 3e-13 gb|AAM12971.1| unknown protein [Arabidopsis thaliana] 80 3e-13 ref|NP_850463.1| protein phosphatase 2C [Arabidopsis thaliana] g... 80 3e-13 ref|XP_004495838.1| PREDICTED: protein phosphatase 2C 32-like [C... 79 5e-13 ref|XP_006651427.1| PREDICTED: protein phosphatase 2C 32-like [O... 79 7e-13 ref|XP_004984261.1| PREDICTED: protein phosphatase 2C 32-like [S... 79 7e-13 >ref|XP_006577191.1| PREDICTED: protein phosphatase 2C 32-like isoform X1 [Glycine max] gi|571446801|ref|XP_006577192.1| PREDICTED: protein phosphatase 2C 32-like isoform X2 [Glycine max] Length = 887 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 126 GMDFHELL+IPHGDRRKYHDDVSVMVVSLEGRIWRSSG Sbjct: 850 GMDFHELLDIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 887 >ref|XP_006491445.1| PREDICTED: protein phosphatase 2C 32-like isoform X1 [Citrus sinensis] gi|568876774|ref|XP_006491446.1| PREDICTED: protein phosphatase 2C 32-like isoform X2 [Citrus sinensis] Length = 879 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 126 GMDFHELL+IPHGDRRKYHDDVSVMVVSLEGRIWRSSG Sbjct: 842 GMDFHELLDIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 879 >ref|XP_006444652.1| hypothetical protein CICLE_v10018806mg [Citrus clementina] gi|557546914|gb|ESR57892.1| hypothetical protein CICLE_v10018806mg [Citrus clementina] Length = 879 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 126 GMDFHELL+IPHGDRRKYHDDVSVMVVSLEGRIWRSSG Sbjct: 842 GMDFHELLDIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 879 >ref|XP_006840417.1| hypothetical protein AMTR_s00045p00156730 [Amborella trichopoda] gi|548842135|gb|ERN02092.1| hypothetical protein AMTR_s00045p00156730 [Amborella trichopoda] Length = 918 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 126 GMDFHELL+IPHGDRRKYHDDVSVMVVSLEGRIWRSSG Sbjct: 881 GMDFHELLDIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 918 >ref|XP_007051333.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao] gi|508703594|gb|EOX95490.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao] Length = 896 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 126 GMDFHELL+IPHGDRRKYHDDVSVMVVSLEGRIWRSSG Sbjct: 859 GMDFHELLDIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 896 >ref|XP_003554585.1| PREDICTED: protein phosphatase 2C 32-like [Glycine max] Length = 887 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 126 GMDFHELL+IPHGDRRKYHDDVSVMVVSLEGRIWRSSG Sbjct: 850 GMDFHELLDIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 887 >emb|CBI37033.3| unnamed protein product [Vitis vinifera] Length = 180 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 126 GMDFHELL+IPHGDRRKYHDDVSVMVVSLEGRIWRSSG Sbjct: 143 GMDFHELLDIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 180 >ref|XP_002280642.1| PREDICTED: protein phosphatase 2C 32-like [Vitis vinifera] Length = 910 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 126 GMDFHELL+IPHGDRRKYHDDVSVMVVSLEGRIWRSSG Sbjct: 873 GMDFHELLDIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 910 >ref|XP_002515151.1| protein phosphatase 2c, putative [Ricinus communis] gi|223545631|gb|EEF47135.1| protein phosphatase 2c, putative [Ricinus communis] Length = 907 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 126 GMDFHELL+IPHGDRRKYHDDVSVMVVSLEGRIWRSSG Sbjct: 870 GMDFHELLDIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 907 >emb|CAN83867.1| hypothetical protein VITISV_031357 [Vitis vinifera] Length = 871 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 126 GMDFHELL+IPHGDRRKYHDDVSVMVVSLEGRIWRSSG Sbjct: 834 GMDFHELLDIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 871 >ref|XP_007163261.1| hypothetical protein PHAVU_001G219500g [Phaseolus vulgaris] gi|561036725|gb|ESW35255.1| hypothetical protein PHAVU_001G219500g [Phaseolus vulgaris] Length = 887 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 126 GMDFHELL+IPHGDRRKYHDDVS+MVVSLEGRIWRSSG Sbjct: 850 GMDFHELLDIPHGDRRKYHDDVSLMVVSLEGRIWRSSG 887 >gb|EXB44481.1| Protein phosphatase 2C 32 [Morus notabilis] Length = 902 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 126 GMDFHELL+IPHGDRRKYHDDV VMVVSLEGRIWRSSG Sbjct: 865 GMDFHELLDIPHGDRRKYHDDVYVMVVSLEGRIWRSSG 902 >ref|XP_006397883.1| hypothetical protein EUTSA_v10001308mg [Eutrema salsugineum] gi|557098956|gb|ESQ39336.1| hypothetical protein EUTSA_v10001308mg [Eutrema salsugineum] Length = 858 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG*FFP 114 GM+FH+LL+IP GDRRKYHDDVSVMVVSLEGRIWRSSG ++P Sbjct: 809 GMEFHDLLDIPQGDRRKYHDDVSVMVVSLEGRIWRSSGQYYP 850 >ref|XP_006293665.1| hypothetical protein CARUB_v10022621mg [Capsella rubella] gi|482562373|gb|EOA26563.1| hypothetical protein CARUB_v10022621mg [Capsella rubella] Length = 858 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG*FFP 114 GM+FH+LL+IP GDRRKYHDDVSVMVVSLEGRIWRSSG ++P Sbjct: 809 GMEFHDLLDIPQGDRRKYHDDVSVMVVSLEGRIWRSSGQYYP 850 >ref|XP_002882093.1| hypothetical protein ARALYDRAFT_904163 [Arabidopsis lyrata subsp. lyrata] gi|297327932|gb|EFH58352.1| hypothetical protein ARALYDRAFT_904163 [Arabidopsis lyrata subsp. lyrata] Length = 857 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG*FFP 114 GM+FH+LL+IP GDRRKYHDDVSVMVVSLEGRIWRSSG ++P Sbjct: 808 GMEFHDLLDIPQGDRRKYHDDVSVMVVSLEGRIWRSSGQYYP 849 >gb|AAM12971.1| unknown protein [Arabidopsis thaliana] Length = 856 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG*FFP 114 GM+FH+LL+IP GDRRKYHDDVSVMVVSLEGRIWRSSG ++P Sbjct: 807 GMEFHDLLDIPQGDRRKYHDDVSVMVVSLEGRIWRSSGQYYP 848 >ref|NP_850463.1| protein phosphatase 2C [Arabidopsis thaliana] gi|30690552|ref|NP_850464.1| protein phosphatase 2C [Arabidopsis thaliana] gi|332278134|sp|Q8RWN7.2|P2C32_ARATH RecName: Full=Protein phosphatase 2C 32; Short=AtPP2C32; AltName: Full=Protein POLTERGEIST; AltName: Full=Protein phosphatase 2C POL; Short=PP2C POL gi|330255678|gb|AEC10772.1| protein phosphatase 2C [Arabidopsis thaliana] gi|330255679|gb|AEC10773.1| protein phosphatase 2C [Arabidopsis thaliana] Length = 856 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG*FFP 114 GM+FH+LL+IP GDRRKYHDDVSVMVVSLEGRIWRSSG ++P Sbjct: 807 GMEFHDLLDIPQGDRRKYHDDVSVMVVSLEGRIWRSSGQYYP 848 >ref|XP_004495838.1| PREDICTED: protein phosphatase 2C 32-like [Cicer arietinum] Length = 897 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 126 GM+FHELL+IPHGDRRKYHDDVSVMVVSLEGRIW+SSG Sbjct: 860 GMNFHELLDIPHGDRRKYHDDVSVMVVSLEGRIWKSSG 897 >ref|XP_006651427.1| PREDICTED: protein phosphatase 2C 32-like [Oryza brachyantha] Length = 931 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 126 GMDFHELL+IP GDRRKYHDDVSVMV+SLEGRIWRSSG Sbjct: 894 GMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSSG 931 >ref|XP_004984261.1| PREDICTED: protein phosphatase 2C 32-like [Setaria italica] Length = 964 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 239 GMDFHELLEIPHGDRRKYHDDVSVMVVSLEGRIWRSSG 126 GMDFHELL+IP GDRRKYHDDVSVMV+SLEGRIWRSSG Sbjct: 927 GMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSSG 964