BLASTX nr result
ID: Akebia25_contig00034466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00034466 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME44202.1| hypothetical protein DOTSEDRAFT_44481 [Dothistrom... 65 7e-09 gb|EMF10830.1| hypothetical protein SEPMUDRAFT_150805 [Sphaeruli... 64 3e-08 ref|XP_003852655.1| hypothetical protein MYCGRDRAFT_109465 [Zymo... 57 2e-06 >gb|EME44202.1| hypothetical protein DOTSEDRAFT_44481 [Dothistroma septosporum NZE10] Length = 592 Score = 65.5 bits (158), Expect = 7e-09 Identities = 38/61 (62%), Positives = 43/61 (70%), Gaps = 4/61 (6%) Frame = -3 Query: 263 PGP-DYFEERKTVIEERAPSQ---ALVVQRSEFRSDTDIQAEIIRLEAERKALRLERGDE 96 PGP +++EERKTVIEERAPS LV+ RSD DI EI LEAER+ALRLER E Sbjct: 470 PGPPEFYEERKTVIEERAPSHNHGTLVLAEHSHRSDRDINGEIRALEAERRALRLEREAE 529 Query: 95 E 93 E Sbjct: 530 E 530 >gb|EMF10830.1| hypothetical protein SEPMUDRAFT_150805 [Sphaerulina musiva SO2202] Length = 578 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/60 (56%), Positives = 42/60 (70%), Gaps = 5/60 (8%) Frame = -3 Query: 257 PDYFEERKTVIEERAPSQ-----ALVVQRSEFRSDTDIQAEIIRLEAERKALRLERGDEE 93 P+Y+EERKT+IEERAPS +LV+ +SD DI EI LEAER+ALRLER E+ Sbjct: 457 PEYYEERKTIIEERAPSHHHHAGSLVLSERHHQSDRDINQEIRALEAERRALRLERDAEQ 516 >ref|XP_003852655.1| hypothetical protein MYCGRDRAFT_109465 [Zymoseptoria tritici IPO323] gi|339472536|gb|EGP87631.1| hypothetical protein MYCGRDRAFT_109465 [Zymoseptoria tritici IPO323] Length = 576 Score = 57.4 bits (137), Expect = 2e-06 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 13/76 (17%) Frame = -3 Query: 266 LPGP-DYFEERKTVIEERAPSQ----------ALVVQ-RSEFRSDTDIQAEIIRLEAERK 123 +P P +Y+EER ++EERAPS ALVVQ RS++RSD DI EI LE+ER+ Sbjct: 440 IPAPAEYYEER--IVEERAPSSHRHRSASHGGALVVQERSDYRSDRDINQEIRALESERR 497 Query: 122 ALRLER-GDEETQLAL 78 AL+LER +E+ ++AL Sbjct: 498 ALKLEREAEEKREMAL 513