BLASTX nr result
ID: Akebia25_contig00033983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00033983 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535072.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 >ref|XP_002535072.1| conserved hypothetical protein [Ricinus communis] gi|223524099|gb|EEF27313.1| conserved hypothetical protein [Ricinus communis] Length = 141 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 267 SLPDLTRPLTPIEITLAYSENILETCLPYFPLGKPLQKD 151 SLP LTRPL PIE+ LAYSE +L TCLP+FPL K L+ + Sbjct: 101 SLPGLTRPLYPIEVRLAYSETVLGTCLPFFPLDKQLRSE 139