BLASTX nr result
ID: Akebia25_contig00033963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00033963 (428 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC10297.1| hypothetical protein L484_006192 [Morus notabilis] 73 5e-11 ref|XP_007200359.1| hypothetical protein PRUPE_ppa008200mg [Prun... 70 4e-10 ref|XP_006394476.1| hypothetical protein EUTSA_v10004503mg [Eutr... 69 5e-10 ref|XP_002320344.2| hypothetical protein POPTR_0014s12420g [Popu... 69 7e-10 ref|XP_002269158.1| PREDICTED: peter Pan-like protein [Vitis vin... 69 9e-10 ref|XP_004156888.1| PREDICTED: LOW QUALITY PROTEIN: capsanthin/c... 68 1e-09 ref|XP_004152249.1| PREDICTED: peter Pan-like protein-like [Cucu... 68 1e-09 ref|XP_006347693.1| PREDICTED: peter Pan-like protein-like isofo... 68 1e-09 ref|NP_568939.2| Peter Pan-like protein [Arabidopsis thaliana] g... 67 2e-09 ref|XP_006479959.1| PREDICTED: peter Pan-like protein-like isofo... 66 4e-09 ref|XP_006444352.1| hypothetical protein CICLE_v10023300mg, part... 66 4e-09 ref|XP_006280850.1| hypothetical protein CARUB_v10026836mg [Caps... 66 4e-09 ref|XP_002864754.1| brix domain-containing protein [Arabidopsis ... 66 4e-09 ref|XP_003540635.1| PREDICTED: peter Pan-like protein-like [Glyc... 65 1e-08 ref|XP_006846972.1| hypothetical protein AMTR_s00017p00083690 [A... 64 2e-08 ref|XP_002523084.1| Protein Peter pan, putative [Ricinus communi... 64 2e-08 ref|NP_851242.1| Peter Pan-like protein [Arabidopsis thaliana] g... 64 2e-08 ref|XP_007050923.1| PETER PAN-like protein isoform 2 [Theobroma ... 64 3e-08 ref|XP_007050922.1| PETER PAN-like protein isoform 1 [Theobroma ... 64 3e-08 ref|XP_002987962.1| hypothetical protein SELMODRAFT_126946 [Sela... 64 3e-08 >gb|EXC10297.1| hypothetical protein L484_006192 [Morus notabilis] Length = 101 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYGNEDGTNK 309 AVKLQEIG RMTLQLIKVEEGLCSGG+IFSEYGN DG K Sbjct: 16 AVKLQEIGARMTLQLIKVEEGLCSGGVIFSEYGNGDGKKK 55 >ref|XP_007200359.1| hypothetical protein PRUPE_ppa008200mg [Prunus persica] gi|462395759|gb|EMJ01558.1| hypothetical protein PRUPE_ppa008200mg [Prunus persica] Length = 341 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYGNEDG 318 AVKLQEIGPRMTLQL+K+EEGLCSGG+IF E+GN DG Sbjct: 270 AVKLQEIGPRMTLQLMKIEEGLCSGGVIFDEFGNGDG 306 >ref|XP_006394476.1| hypothetical protein EUTSA_v10004503mg [Eutrema salsugineum] gi|557091115|gb|ESQ31762.1| hypothetical protein EUTSA_v10004503mg [Eutrema salsugineum] Length = 348 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYGNEDGTN 312 AVKLQEIGPRMT+QL+KVEEGLCSGGIIFSEY N D N Sbjct: 272 AVKLQEIGPRMTMQLVKVEEGLCSGGIIFSEYENVDEKN 310 >ref|XP_002320344.2| hypothetical protein POPTR_0014s12420g [Populus trichocarpa] gi|550324060|gb|EEE98659.2| hypothetical protein POPTR_0014s12420g [Populus trichocarpa] Length = 322 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/42 (78%), Positives = 38/42 (90%), Gaps = 2/42 (4%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYG--NEDGTNK 309 AVKLQEIGPRMTLQL+K+EEGLCSGG+IFSEYG +E+G K Sbjct: 261 AVKLQEIGPRMTLQLVKIEEGLCSGGVIFSEYGTASENGQEK 302 >ref|XP_002269158.1| PREDICTED: peter Pan-like protein [Vitis vinifera] gi|297743890|emb|CBI36860.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYGNE 324 AVKLQEIGPRMTLQLIK+EEGLCSGG+IF+ YGNE Sbjct: 270 AVKLQEIGPRMTLQLIKIEEGLCSGGVIFNAYGNE 304 >ref|XP_004156888.1| PREDICTED: LOW QUALITY PROTEIN: capsanthin/capsorubin synthase, chromoplast-like [Cucumis sativus] Length = 569 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYGNE 324 AVKLQEIGPR+TLQLIKVEEGLCSGGIIF+EYG E Sbjct: 496 AVKLQEIGPRLTLQLIKVEEGLCSGGIIFNEYGGE 530 >ref|XP_004152249.1| PREDICTED: peter Pan-like protein-like [Cucumis sativus] Length = 344 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYGNE 324 AVKLQEIGPR+TLQLIKVEEGLCSGGIIF+EYG E Sbjct: 271 AVKLQEIGPRLTLQLIKVEEGLCSGGIIFNEYGGE 305 >ref|XP_006347693.1| PREDICTED: peter Pan-like protein-like isoform X1 [Solanum tuberosum] gi|565361908|ref|XP_006347694.1| PREDICTED: peter Pan-like protein-like isoform X2 [Solanum tuberosum] Length = 346 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYGNED 321 AVKLQEIGPRMTLQL+K+EEGLC+GG++F+EYGN D Sbjct: 270 AVKLQEIGPRMTLQLVKIEEGLCTGGLLFNEYGNVD 305 >ref|NP_568939.2| Peter Pan-like protein [Arabidopsis thaliana] gi|42573760|ref|NP_974976.1| Peter Pan-like protein [Arabidopsis thaliana] gi|10176870|dbj|BAB10077.1| unnamed protein product [Arabidopsis thaliana] gi|332010132|gb|AED97515.1| Peter Pan-like protein [Arabidopsis thaliana] gi|332010133|gb|AED97516.1| Peter Pan-like protein [Arabidopsis thaliana] Length = 346 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYGNEDG 318 AVKLQEIGPRMT+QL+KVEEGLC+GGIIFSEY + DG Sbjct: 272 AVKLQEIGPRMTMQLVKVEEGLCTGGIIFSEYEDVDG 308 >ref|XP_006479959.1| PREDICTED: peter Pan-like protein-like isoform X1 [Citrus sinensis] gi|568852600|ref|XP_006479960.1| PREDICTED: peter Pan-like protein-like isoform X2 [Citrus sinensis] Length = 335 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYG 330 AVKLQEIGPRMTLQLIKVEEGLCSG IIFSEYG Sbjct: 271 AVKLQEIGPRMTLQLIKVEEGLCSGSIIFSEYG 303 >ref|XP_006444352.1| hypothetical protein CICLE_v10023300mg, partial [Citrus clementina] gi|557546614|gb|ESR57592.1| hypothetical protein CICLE_v10023300mg, partial [Citrus clementina] Length = 351 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYG 330 AVKLQEIGPRMTLQLIKVEEGLCSG IIFSEYG Sbjct: 287 AVKLQEIGPRMTLQLIKVEEGLCSGSIIFSEYG 319 >ref|XP_006280850.1| hypothetical protein CARUB_v10026836mg [Capsella rubella] gi|482549554|gb|EOA13748.1| hypothetical protein CARUB_v10026836mg [Capsella rubella] Length = 306 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYG 330 AVKLQEIGPRMT+QL+KVEEGLC+GGIIFSEYG Sbjct: 272 AVKLQEIGPRMTMQLVKVEEGLCTGGIIFSEYG 304 >ref|XP_002864754.1| brix domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297310589|gb|EFH41013.1| brix domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 304 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYG 330 AVKLQEIGPRMT+QL+KVEEGLC+GGIIFSEYG Sbjct: 272 AVKLQEIGPRMTMQLVKVEEGLCTGGIIFSEYG 304 >ref|XP_003540635.1| PREDICTED: peter Pan-like protein-like [Glycine max] Length = 348 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYGNEDGTNK 309 AVKLQE+GPRMTLQL+K+E+GLCSG ++FSEYG G K Sbjct: 273 AVKLQEVGPRMTLQLVKIEKGLCSGEVLFSEYGKAGGKGK 312 >ref|XP_006846972.1| hypothetical protein AMTR_s00017p00083690 [Amborella trichopoda] gi|548850001|gb|ERN08553.1| hypothetical protein AMTR_s00017p00083690 [Amborella trichopoda] Length = 383 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEY 333 AVKLQEIGPRMTLQL+K+EEGLCSGGIIF+EY Sbjct: 274 AVKLQEIGPRMTLQLVKIEEGLCSGGIIFNEY 305 >ref|XP_002523084.1| Protein Peter pan, putative [Ricinus communis] gi|223537646|gb|EEF39269.1| Protein Peter pan, putative [Ricinus communis] Length = 341 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYGNEDGTNK 309 AVKLQE+GPRMTLQLIKVEEGLCSG +IF+EYG K Sbjct: 270 AVKLQELGPRMTLQLIKVEEGLCSGALIFNEYGTTSDKTK 309 >ref|NP_851242.1| Peter Pan-like protein [Arabidopsis thaliana] gi|24212091|sp|Q9ASU7.1|PPAN_ARATH RecName: Full=Peter Pan-like protein gi|13605686|gb|AAK32836.1|AF361824_1 AT5g61770/mac9_70 [Arabidopsis thaliana] gi|15810077|gb|AAL06964.1| At1g06730/F4H5_22 [Arabidopsis thaliana] gi|17979000|gb|AAL47460.1| AT5g61770/mac9_70 [Arabidopsis thaliana] gi|332010131|gb|AED97514.1| Peter Pan-like protein [Arabidopsis thaliana] Length = 345 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEY 333 AVKLQEIGPRMT+QL+KVEEGLC+GGIIFSEY Sbjct: 272 AVKLQEIGPRMTMQLVKVEEGLCTGGIIFSEY 303 >ref|XP_007050923.1| PETER PAN-like protein isoform 2 [Theobroma cacao] gi|508703184|gb|EOX95080.1| PETER PAN-like protein isoform 2 [Theobroma cacao] Length = 299 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYGN 327 AVKLQEIGPRMTLQLIKVE GLCSG ++FSEYGN Sbjct: 221 AVKLQEIGPRMTLQLIKVEGGLCSGEVMFSEYGN 254 >ref|XP_007050922.1| PETER PAN-like protein isoform 1 [Theobroma cacao] gi|508703183|gb|EOX95079.1| PETER PAN-like protein isoform 1 [Theobroma cacao] Length = 354 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYGN 327 AVKLQEIGPRMTLQLIKVE GLCSG ++FSEYGN Sbjct: 276 AVKLQEIGPRMTLQLIKVEGGLCSGEVMFSEYGN 309 >ref|XP_002987962.1| hypothetical protein SELMODRAFT_126946 [Selaginella moellendorffii] gi|300144351|gb|EFJ11036.1| hypothetical protein SELMODRAFT_126946 [Selaginella moellendorffii] Length = 344 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -1 Query: 428 AVKLQEIGPRMTLQLIKVEEGLCSGGIIFSEYGNEDGTNK 309 AVKL EIGPRMTLQL+KVEEGLCSG ++F EYG E+ K Sbjct: 247 AVKLHEIGPRMTLQLVKVEEGLCSGAVMFHEYGIEENKKK 286