BLASTX nr result
ID: Akebia25_contig00033948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00033948 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC95927.1| hypothetical protein BAUCODRAFT_34686 [Baudoinia ... 76 6e-12 gb|EKG17726.1| Peptidase A1 [Macrophomina phaseolina MS6] 75 7e-12 ref|XP_007582583.1| putative aspartic endopeptidase pep2 protein... 74 2e-11 gb|EON67912.1| vacuolar protease A [Coniosporium apollinis CBS 1... 73 4e-11 gb|EUN21961.1| hypothetical protein COCVIDRAFT_112679 [Bipolaris... 73 5e-11 gb|EUC29353.1| hypothetical protein COCCADRAFT_8417 [Bipolaris z... 73 5e-11 gb|EMF12616.1| aspartyl proteinase [Sphaerulina musiva SO2202] 73 5e-11 gb|EME80829.1| hypothetical protein MYCFIDRAFT_89289 [Pseudocerc... 73 5e-11 ref|XP_754479.1| aspartic endopeptidase Pep2 [Aspergillus fumiga... 73 5e-11 gb|AAA20876.1| pepsinogen [Aspergillus niger] gi|350634685|gb|EH... 72 6e-11 dbj|GAA88863.1| aspartic protease (PepE) [Aspergillus kawachii I... 72 6e-11 ref|XP_001941895.1| vacuolar protease A precursor [Pyrenophora t... 72 6e-11 ref|XP_001399855.1| vacuolar protease A [Aspergillus niger CBS 5... 72 6e-11 ref|XP_001819842.1| vacuolar protease A [Aspergillus oryzae RIB4... 72 8e-11 gb|EUC51427.1| hypothetical protein COCMIDRAFT_79427 [Bipolaris ... 72 8e-11 gb|EMD84649.1| hypothetical protein COCHEDRAFT_1189444 [Bipolari... 72 8e-11 gb|EMD66453.1| hypothetical protein COCSADRAFT_34972 [Bipolaris ... 72 8e-11 ref|XP_002479865.1| aspartic endopeptidase Pep2 [Talaromyces sti... 72 8e-11 ref|XP_001213854.1| vacuolar protease A precursor [Aspergillus t... 72 8e-11 ref|XP_660507.1| hypothetical protein AN2903.2 [Aspergillus nidu... 72 8e-11 >gb|EMC95927.1| hypothetical protein BAUCODRAFT_34686 [Baudoinia compniacensis UAMH 10762] Length = 376 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 DIPEPAGPLAILGDAFLRKWYSVYDLGN+AVGLAKA Sbjct: 340 DIPEPAGPLAILGDAFLRKWYSVYDLGNNAVGLAKA 375 >gb|EKG17726.1| Peptidase A1 [Macrophomina phaseolina MS6] Length = 378 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 D PEPAGPLAILGDAFLRKWYSVYDLGNDAVG+AKA Sbjct: 342 DFPEPAGPLAILGDAFLRKWYSVYDLGNDAVGIAKA 377 >ref|XP_007582583.1| putative aspartic endopeptidase pep2 protein [Neofusicoccum parvum UCRNP2] gi|485925261|gb|EOD49884.1| putative aspartic endopeptidase pep2 protein [Neofusicoccum parvum UCRNP2] Length = 400 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 D PEPAGPLAILGDAFLRKWYSVYDLGN+AVGLAKA Sbjct: 364 DFPEPAGPLAILGDAFLRKWYSVYDLGNNAVGLAKA 399 >gb|EON67912.1| vacuolar protease A [Coniosporium apollinis CBS 100218] Length = 400 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 D PEPAGPLAILGDAFLR+WYSVYDLGN+AVGLAKA Sbjct: 363 DFPEPAGPLAILGDAFLRRWYSVYDLGNNAVGLAKA 398 >gb|EUN21961.1| hypothetical protein COCVIDRAFT_112679 [Bipolaris victoriae FI3] Length = 399 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 DIPEPAGPL ILGDAFLRKWYSVYDLGN AVGLAK+ Sbjct: 363 DIPEPAGPLVILGDAFLRKWYSVYDLGNSAVGLAKS 398 >gb|EUC29353.1| hypothetical protein COCCADRAFT_8417 [Bipolaris zeicola 26-R-13] Length = 399 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 DIPEPAGPL ILGDAFLRKWYSVYDLGN AVGLAK+ Sbjct: 363 DIPEPAGPLVILGDAFLRKWYSVYDLGNSAVGLAKS 398 >gb|EMF12616.1| aspartyl proteinase [Sphaerulina musiva SO2202] Length = 396 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 DIPEPAGPLAILGDAFLRKWYSVYDL N+AVGLAKA Sbjct: 360 DIPEPAGPLAILGDAFLRKWYSVYDLENNAVGLAKA 395 >gb|EME80829.1| hypothetical protein MYCFIDRAFT_89289 [Pseudocercospora fijiensis CIRAD86] Length = 396 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 DIPEPAGPLAILGDAFLRKWYSVYDLG+++VGLAKA Sbjct: 360 DIPEPAGPLAILGDAFLRKWYSVYDLGSNSVGLAKA 395 >ref|XP_754479.1| aspartic endopeptidase Pep2 [Aspergillus fumigatus Af293] gi|74675969|sp|O42630.1|CARP_ASPFU RecName: Full=Vacuolar protease A; AltName: Full=Aspartic endopeptidase pep2; AltName: Full=Aspartic protease pep2; Flags: Precursor gi|2664292|emb|CAA75754.1| cellular aspartic protease [Aspergillus fumigatus] gi|4200293|emb|CAA10674.1| aspartic protease [Aspergillus fumigatus] gi|66852116|gb|EAL92441.1| aspartic endopeptidase Pep2 [Aspergillus fumigatus Af293] gi|159127496|gb|EDP52611.1| aspartic endopeptidase Pep2 [Aspergillus fumigatus A1163] Length = 398 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 D PEP GPLAILGDAFLRKWYSVYDLGN+AVGLAKA Sbjct: 362 DFPEPVGPLAILGDAFLRKWYSVYDLGNNAVGLAKA 397 >gb|AAA20876.1| pepsinogen [Aspergillus niger] gi|350634685|gb|EHA23047.1| extracellular aspartic protease [Aspergillus niger ATCC 1015] Length = 398 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 D PEP GPLAILGDAFLRKWYSVYDLGN AVGLAKA Sbjct: 362 DFPEPVGPLAILGDAFLRKWYSVYDLGNSAVGLAKA 397 >dbj|GAA88863.1| aspartic protease (PepE) [Aspergillus kawachii IFO 4308] Length = 398 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 D PEP GPLAILGDAFLRKWYSVYDLGN AVGLAKA Sbjct: 362 DFPEPVGPLAILGDAFLRKWYSVYDLGNSAVGLAKA 397 >ref|XP_001941895.1| vacuolar protease A precursor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977988|gb|EDU44614.1| vacuolar protease A precursor [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 399 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 D PEP GPLAILGDAFLRKWYSVYDLGN AVGLAKA Sbjct: 363 DFPEPVGPLAILGDAFLRKWYSVYDLGNSAVGLAKA 398 >ref|XP_001399855.1| vacuolar protease A [Aspergillus niger CBS 513.88] gi|134056777|emb|CAK37685.1| aspartic protease pepE-Aspergillus niger Length = 398 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 D PEP GPLAILGDAFLRKWYSVYDLGN AVGLAKA Sbjct: 362 DFPEPVGPLAILGDAFLRKWYSVYDLGNSAVGLAKA 397 >ref|XP_001819842.1| vacuolar protease A [Aspergillus oryzae RIB40] gi|238486794|ref|XP_002374635.1| aspartic endopeptidase Pep2 [Aspergillus flavus NRRL3357] gi|21392388|dbj|BAC00850.1| pepsinogen [Aspergillus oryzae] gi|83767701|dbj|BAE57840.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220699514|gb|EED55853.1| aspartic endopeptidase Pep2 [Aspergillus flavus NRRL3357] gi|391867458|gb|EIT76704.1| aspartyl protease [Aspergillus oryzae 3.042] Length = 397 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 D PEP GPLAILGDAFLRKWYSVYDLGN AVGLAKA Sbjct: 361 DFPEPVGPLAILGDAFLRKWYSVYDLGNGAVGLAKA 396 >gb|EUC51427.1| hypothetical protein COCMIDRAFT_79427 [Bipolaris oryzae ATCC 44560] Length = 399 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 DIPEPAGPLAILGDAFLRKWYSVYDLGN AV LAK+ Sbjct: 363 DIPEPAGPLAILGDAFLRKWYSVYDLGNSAVALAKS 398 >gb|EMD84649.1| hypothetical protein COCHEDRAFT_1189444 [Bipolaris maydis C5] gi|452004574|gb|EMD97030.1| hypothetical protein COCHEDRAFT_1189956 [Bipolaris maydis C5] gi|477587424|gb|ENI04506.1| hypothetical protein COCC4DRAFT_198341 [Bipolaris maydis ATCC 48331] Length = 399 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 DIPEPAGPLAILGDAFLRKWYSVYDLGN AV LAK+ Sbjct: 363 DIPEPAGPLAILGDAFLRKWYSVYDLGNSAVALAKS 398 >gb|EMD66453.1| hypothetical protein COCSADRAFT_34972 [Bipolaris sorokiniana ND90Pr] Length = 399 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 DIPEPAGPLAILGDAFLRKWYSVYDLGN AV LAK+ Sbjct: 363 DIPEPAGPLAILGDAFLRKWYSVYDLGNSAVALAKS 398 >ref|XP_002479865.1| aspartic endopeptidase Pep2 [Talaromyces stipitatus ATCC 10500] gi|218720012|gb|EED19431.1| aspartic endopeptidase Pep2 [Talaromyces stipitatus ATCC 10500] Length = 395 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 D PEP GPLAILGDAFLRKWYSVYDLGN AVGLAKA Sbjct: 359 DFPEPVGPLAILGDAFLRKWYSVYDLGNGAVGLAKA 394 >ref|XP_001213854.1| vacuolar protease A precursor [Aspergillus terreus NIH2624] gi|114193423|gb|EAU35123.1| vacuolar protease A precursor [Aspergillus terreus NIH2624] Length = 397 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 D PEP GPLAILGDAFLRKWYSVYDLGN AVGLAKA Sbjct: 361 DFPEPVGPLAILGDAFLRKWYSVYDLGNGAVGLAKA 396 >ref|XP_660507.1| hypothetical protein AN2903.2 [Aspergillus nidulans FGSC A4] gi|40744298|gb|EAA63474.1| hypothetical protein AN2903.2 [Aspergillus nidulans FGSC A4] gi|259486160|tpe|CBF83780.1| TPA: vacuolar aspartyl protease (proteinase A) (Eurofung) [Aspergillus nidulans FGSC A4] Length = 394 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 277 DIPEPAGPLAILGDAFLRKWYSVYDLGNDAVGLAKA 170 D PEP GPLAILGDAFLRKWYSVYDLGN AVGLAKA Sbjct: 358 DFPEPVGPLAILGDAFLRKWYSVYDLGNGAVGLAKA 393