BLASTX nr result
ID: Akebia25_contig00033850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00033850 (263 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28942.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002273713.1| PREDICTED: glutamate receptor 3.7 [Vitis vin... 64 2e-08 ref|XP_002524180.1| glutamate receptor 3 plant, putative [Ricinu... 59 9e-07 ref|XP_007045627.1| Glutamate receptor isoform 1 [Theobroma caca... 57 2e-06 ref|XP_002301626.1| Glutamate receptor 3.7 precursor family prot... 55 8e-06 >emb|CBI28942.3| unnamed protein product [Vitis vinifera] Length = 838 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +2 Query: 41 TRCAQVVYNFFDFIDEKEEAIKKIFKQCENPIQQAS 148 TRC+QV+YNFFDFIDEKEEAIKK+FKQ ENP Q S Sbjct: 803 TRCSQVIYNFFDFIDEKEEAIKKMFKQQENPQPQVS 838 >ref|XP_002273713.1| PREDICTED: glutamate receptor 3.7 [Vitis vinifera] Length = 909 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +2 Query: 41 TRCAQVVYNFFDFIDEKEEAIKKIFKQCENPIQQAS 148 TRC+QV+YNFFDFIDEKEEAIKK+FKQ ENP Q S Sbjct: 874 TRCSQVIYNFFDFIDEKEEAIKKMFKQQENPQPQVS 909 >ref|XP_002524180.1| glutamate receptor 3 plant, putative [Ricinus communis] gi|223536549|gb|EEF38195.1| glutamate receptor 3 plant, putative [Ricinus communis] Length = 921 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = +2 Query: 41 TRCAQVVYNFFDFIDEKEEAIKKIFKQCENPIQQAS 148 TRC+Q++++FFDFID+KEEAIKK+F QC++P Q S Sbjct: 882 TRCSQIIFHFFDFIDKKEEAIKKMFMQCDHPAPQVS 917 >ref|XP_007045627.1| Glutamate receptor isoform 1 [Theobroma cacao] gi|508709562|gb|EOY01459.1| Glutamate receptor isoform 1 [Theobroma cacao] Length = 922 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +2 Query: 41 TRCAQVVYNFFDFIDEKEEAIKKIFKQCE 127 TRC+QV+YNFF+FIDEKEEAIKK+F QCE Sbjct: 881 TRCSQVIYNFFNFIDEKEEAIKKMFMQCE 909 >ref|XP_002301626.1| Glutamate receptor 3.7 precursor family protein [Populus trichocarpa] gi|222843352|gb|EEE80899.1| Glutamate receptor 3.7 precursor family protein [Populus trichocarpa] Length = 861 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +2 Query: 41 TRCAQVVYNFFDFIDEKEEAIKKIFKQCENPIQQAS 148 TRC+ V+Y+FFDFIDE+EEAIKK+F Q E+P QA+ Sbjct: 825 TRCSHVIYHFFDFIDEREEAIKKMFNQREHPHPQAN 860