BLASTX nr result
ID: Akebia25_contig00033600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00033600 (838 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006483707.1| PREDICTED: lysM domain receptor-like kinase ... 63 2e-07 ref|XP_006450454.1| hypothetical protein CICLE_v10010636mg, part... 63 2e-07 ref|XP_002309617.1| hypothetical protein POPTR_0006s26880g [Popu... 62 4e-07 ref|XP_007011884.1| Kinase family protein / peptidoglycan-bindin... 58 4e-06 emb|CBI21029.3| unnamed protein product [Vitis vinifera] 58 4e-06 ref|XP_002282620.1| PREDICTED: probable LRR receptor-like serine... 58 4e-06 >ref|XP_006483707.1| PREDICTED: lysM domain receptor-like kinase 3-like [Citrus sinensis] Length = 580 Score = 62.8 bits (151), Expect = 2e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 498 GYAAGGDSLFLVYEYAQNGALSDHLHNPANKG 403 GYAAGGDSLFLVYEYAQNGALSDHLH P+ KG Sbjct: 338 GYAAGGDSLFLVYEYAQNGALSDHLHWPSVKG 369 >ref|XP_006450454.1| hypothetical protein CICLE_v10010636mg, partial [Citrus clementina] gi|557553680|gb|ESR63694.1| hypothetical protein CICLE_v10010636mg, partial [Citrus clementina] Length = 427 Score = 62.8 bits (151), Expect = 2e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 498 GYAAGGDSLFLVYEYAQNGALSDHLHNPANKG 403 GYAAGGDSLFLVYEYAQNGALSDHLH P+ KG Sbjct: 263 GYAAGGDSLFLVYEYAQNGALSDHLHWPSVKG 294 >ref|XP_002309617.1| hypothetical protein POPTR_0006s26880g [Populus trichocarpa] gi|222855593|gb|EEE93140.1| hypothetical protein POPTR_0006s26880g [Populus trichocarpa] Length = 329 Score = 61.6 bits (148), Expect = 4e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 498 GYAAGGDSLFLVYEYAQNGALSDHLHNPANKG 403 GYAAGG+SLFLVYE+AQNGALS+HLHNPA +G Sbjct: 82 GYAAGGESLFLVYEFAQNGALSNHLHNPALRG 113 >ref|XP_007011884.1| Kinase family protein / peptidoglycan-binding LysM domain-containing protein [Theobroma cacao] gi|508782247|gb|EOY29503.1| Kinase family protein / peptidoglycan-binding LysM domain-containing protein [Theobroma cacao] Length = 615 Score = 58.2 bits (139), Expect = 4e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 498 GYAAGGDSLFLVYEYAQNGALSDHLHNPANKG 403 GYAAGGDSLFLVYE+AQNGALSDHLH +G Sbjct: 360 GYAAGGDSLFLVYEFAQNGALSDHLHGSTLRG 391 >emb|CBI21029.3| unnamed protein product [Vitis vinifera] Length = 262 Score = 58.2 bits (139), Expect = 4e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -2 Query: 498 GYAAGGDSLFLVYEYAQNGALSDHLHNPANKGLSLLD 388 GYA GGDSLFLVYE+AQNGALS HLH P +G L+ Sbjct: 82 GYAGGGDSLFLVYEFAQNGALSHHLHRPTARGYKPLE 118 >ref|XP_002282620.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g51810-like [Vitis vinifera] Length = 593 Score = 58.2 bits (139), Expect = 4e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -2 Query: 498 GYAAGGDSLFLVYEYAQNGALSDHLHNPANKGLSLLD 388 GYA GGDSLFLVYE+AQNGALS HLH P +G L+ Sbjct: 353 GYAGGGDSLFLVYEFAQNGALSHHLHRPTARGYKPLE 389